G2 Agent Template Details

Updated Jun 18, 2024

Agent G2 - Active Directory Free System Page Table Entries DotNet v4

Description

Monitors Active Directory Free System Page Table Entries Counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Active Directory Free System Page Table Entries DotNet v4	AD_Free_System_Page_Table_Entries	FreeSystemPageTableEntries	NULL	Free System Page Table Entries is the number of page table entries not currently in used by the system. This counter displays the last observed value only; it is not an average

Agent G2 - Active Directory Performance Counters DotNet v4

Description

Monitors AD Performance data

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Active Directory Performance Counters DotNet v4	DRAInboundObjectsPersec	DRAInboundObjectsPersec	NULL	The number of objects received (per second) through inbound replication from replication partners.
	DSServerBindsPersec	DSServerBindsPersec	NULL	Shows the number of DC-to-DC binds per second that are serviced by this DC.
	DRAInboundBytesTotalPersec	DRAInboundBytesTotalPersec	Bytes per second	It is the sum of the number of bytes (per second) of uncompressed data (never compressed) and compressed data (after compression) received through replication. Lack of activity indicates that the network is slowing down replication.
	DRAInboundObjectsAppliedPersec	DRAInboundObjectsAppliedPersec	NULL	This counter excludes changes that are received but not applied (for example, when the update is already made) and also how many replication updates are occurring on the server as a result of changes generated on other servers.
	ABClientSessions	ABClientSessions	NULL	AB Client Sessions is the number of connected Address Book client sessions.
	LDAPClientSessions	LDAPClientSessions	NULL	The number of sessions of connected LDAP clients. Lack of activity points to network problems.
	DSDirectoryReadsPersec	DSDirectoryReadsPersec	NULL	Shows the number of directory reads per second.
	DRAPendingReplicationSynchronizations	DRAPendingReplicationSynchronizations	NULL	The number of directory synchronizations that are queued for this server that are not yet processed. This counter helps in determining replication backlog - the larger the number, the larger the backlog. This value should be low, with a higher value indicating that the hardware is not adequately servicing replication.
	NTLMAuthentications	NTLMAuthentications	NULL	The number of NTLM authentications (per second) serviced by this domain controller
	DSDirectoryWritesPersec	DSDirectoryWritesPersec	NULL	Shows the number of directory writes per second.
	LDAPActiveThreads	LDAPActiveThreads	NULL	LDAP Active Threads is the current number of threads in use by the LDAP subsystem of the local direcotry service.
	KerberosAuthentications	KerberosAuthentications	NULL	The number of times per second that clients use a client ticket to this domain controller to authenticate to this domain controller. A lack of activity can indicate network problems that are preventing authentication requests from succeeding.
	DRAOutboundBytesTotalPersec	DRAOutboundBytesTotalPersec	Bytes per second	It is the sum of the number of bytes of uncompressed data (never compressed) and compressed data (after compression) sent per second. Lack of activity indicates that the hardware or network is slowing down replication.
	LDAPWritesPersec	LDAPWritesPersec	NULL	Shows the rate at which LDAP clients perform write operations.
	DSNotifyQueueSize	DSNotifyQueueSize	NULL	The number of pending update notifications that have been queued, but not yet transmitted to clients.
	DSClientBindsPersec	DSClientBindsPersec	NULL	Shows the number of Ntdsapi.dll binds per second serviced by this DC.
	LDAPUDPoperationsPersec	LDAPUDPoperationsPersec	NULL	Shows the number of UDP operations that the LDAP server is processing per second.
	LDAPBindTime	LDAPBindTime	Milliseconds	This counter shows the time required for completion of the last LDAP binding, with a higher value pointing to either hardware or network performance problems.
	LDAPSearchesPersec	LDAPSearchesPersec	NULL	The number of search operations per second performed by LDAP clients. A lack of activity points to network problems.
	DRAOutboundObjectsPersec	DRAOutboundObjectsPersec	NULL	The number of objects sent (per second) through outbound replication to replication partners.
	DRAInboundObjectUpdatesRemaininginPacket	DRAInboundObjectUpdatesRemaininginPacket	NULL	This counter tells you whether the monitored server is receiving changes, but is taking a long time applying them to the database. The value should be low, with a higher value indicating that the hardware is incapable of adequately servicing replication (warranting a server upgrade).

Agent G2 - AD Database Monitoring - v2

Description

Monitor AD database metrics like DBFileSizeGrowth, DBFile_DiskUsage, DiskHealthStatus, FreeDiskSpace.

Note: Previous version “Agent G2 - AD Database Monitoring” template has a bug at the monitor level. We recommend using the latest template (Agent G2 - AD Database Monitoring - v2)

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - AD Database Custom Monitor - v2	AD_Database_DBFileSizeGrowth	AD Database DBFile Size Growth	MB	It monitors the growth of the Active Directory database file size. It calculates the delta of the database file size from previous poll to current poll.
	AD_Database_FreeDiskSpace	AD Database FreeDiskSpace	MB	It monitors the free disk space in MB for the drives which are having Active Directory Database file / Log file.
	AD_Database_DiskHealthStatus	AD Database Disk Health Status	null	It monitors the disk health status of the drive which is having an Active Directory DB File. Below are the possible states: 0 - Healthy 1 - Warning 2 - Unhealthy 3 - Unknown
	AD_Database_DBFile_DiskUsage	AD Database DBFile DiskUsage	%	It monitors the disk usage% of the drive which is having Active Directory DB file.

Agent G2 - AD Performance Counters DotNet v4

Description

Agent G2 - AD Performance Counters DotNet v4

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - AD Performance Counters DotNet v4	directory.services.ldap.successful.binds.per.sec	Directory Services LDAPSuccessfulbindspersec	NULL	Number of LDAP Binds per second
	directory.services.dra.outbound.values.dns.only.per.sec	Directory Services DRAOutboundvaluesdnsonlypersec	NULL	Number of object property values containing Distinguished Names sent to outbound replication partners. DN-values, such as group or distribution list memberships, are generally more expensive to read than other kinds of values
	directory.services.dra.inbound.values.dns.only.per.sec	Directory Services DRAInboundvaluesdnsonlypersec	NULL	Number of object property values received from inbound replication partners that are Distinguished Names; i.e., that reference other objects. DN-values, such as group or distribution list memberships, are generally more expensive to apply than other kind
	directory.services.threads.in.use	Directory Services Threadsinuse	NULL	DS Threads in Use is the current number of threads in use by the directory service (different than the number of threads in the directory service process). Threads in Use is the number of threads currently servicing client API calls and can be used to in
	directory.services.dra.inbound.full.sync.objects.remaining	Directory Services DRAInboundfullsyncobjectsremaining	NULL	Number of objects remaining until the full sync completes (when set)

Agent G2 - Backup Symantec Exec-11-Performance Counters DotNet v4

Description

Template for Symantec backup exec. Monitors total bytes, total directories and total files. Also performs event log monitoring.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Backup Symantec Exec-11-Performance Counters DotNet v4	TotalDirectories	TotalDirectories	NULL	The total number of directories that have been backed up since the Backup Exec Engine Service last started.
	TotalFiles	TotalFiles	NULL	The total number of files that have been backed up since the Backup Exec Engine Service last started.
	TotalBytes	TotalBytes	NULL	The total number of bytes that have been backed up since the Backup Exec Engine Service last started.

Agent G2 - Backup-Symantec Exec-12.5-Performance Counters DotNet v4

Description

12.5_Symantec_Backup_Exec. Monitors total bytes, total directories and total files.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Backup-Symantec Exec-12.5-Performance Counters DotNet v4	TotalBytes	TotalBytes	NULL	The total number of bytes that have been backed up since the Backup Exec Engine Service last started.
	FailedJobs	FailedJobs	NULL	The number of jobs that have failed since the Backup Exec Engine Service last started.
	TotalDirectories	TotalDirectories	NULL	The total number of directories that have been backed up since the Backup Exec Engine Service last started.
	TotalFiles	TotalFiles	NULL	The total number of files that have been backed up since the Backup Exec Engine Service last started.

Agent G2 - Backup-Veritas-Job Performance Counters DotNet v4

Description

Monitors the AbortedJobs, ActiveJobCount, BackupDeviceWaitTime, InUseSkippedObjects MountTime, TotalExchangeMailboxes, TotalSQLServerDatabases.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Backup-Veritas-Job Performance Counters DotNet v4	BackupDeviceWaitTime	BackupDeviceWaitTime	Seconds	The total time (in seconds) all backup jobs have spent waiting for a storage device since the Backup Exec Engine Service last started.
	AbortedJobs	AbortedJobs	NULL	The number of jobs that have been aborted since the Backup Exec Engine Service last started.
	MountTime	MountTime	Seconds	The total time (in seconds) all jobs have spent waiting for media to be mounted in a storage device since the Backup Exec Engine Service last started.
	InUseSkippedObjects	InUseSkippedObjects	NULL	The number of objects that have been skipped because they were in use during backup since the Backup Exec Engine Service last started.
	FailedJobs	FailedJobs	NULL	The number of jobs that have failed since the Backup Exec Engine Service last started.
	ActiveJobCount	ActiveJobCount	NULL	The number of jobs currently active (running or pending) in the Backup Exec Engine Service.

Agent G2 - Blackberry 501 Performance Counters DotNet v4

Description

Monitor Blackberry 501 Performance Counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Blackberry 501 Performance Counters DotNet v4	MessagesQueuedForDelivery	MessagesQueuedForDelivery	NULL	Blackberry Agent displays queued messages for delivery
	MessagesExpired	MessagesExpired	NULL	Blackberry Agent displays expired messages
	MessagesSent	MessagesSent	NULL	Blackberry Agent displays sent messages
	MessagesReceived	MessagesReceived	NULL	Blackberry Agent displays received messages
	MessagesFiltered	MessagesFiltered	NULL	Blackberry Agent displays filtered messages

Agent G2 - Blackberry Enterprise Server

Description

Template for BlackBerry enterprise server. Monitors messages expired, messages filtered, messages queued for delivery, messages received and messages sent. Also performs event log monitoring.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Blackberry Enterprise Server	MessagesQueuedForDelivery	MessagesQueuedForDelivery	NULL	Blackberry Agent displays queued messages for delivery
	MessagesExpired	MessagesExpired	NULL	Blackberry Agent displays expired messages
	MessagesSent	MessagesSent	NULL	Blackberry Agent displays sent messages
	MessagesReceived	MessagesReceived	NULL	Blackberry Agent displays received messages
	MessagesFiltered	MessagesFiltered	NULL	Blackberry Agent displays filtered messages

Agent G2 - Blackberry Performance Counters DotNet v4

Description

Monitors Blackberry Performance Counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Blackberry Performance Counters DotNet v4	MessagesQueuedForDelivery	MessagesQueuedForDelivery	NULL	Blackberry Agent displays queued messages for delivery
	MessagesExpired	MessagesExpired	NULL	Blackberry Agent displays expired messages
	MessagesSent	MessagesSent	NULL	Blackberry Agent displays sent messages
	MessagesReceived	MessagesReceived	NULL	Blackberry Agent displays received messages
	MessagesFiltered	MessagesFiltered	NULL	Blackberry Agent displays filtered messages

Agent G2 - Cisco Unity Performance Counters DotNet v4

Description

Monitors Cisco Unity Performance data

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Cisco Unity Performance Counters DotNet v4	IncomingCallsExternalCurrent	IncomingCallsExternalCurrent	NULL	The current number of incoming calls from external callers.
	PortsIdleCurrent	PortsIdleCurrent	NULL	The current number of integration ports that are not in use by the Cisco Unity Connection server.
	TTSSessionsPersec	TTSSessionsPersec	NULL	The number of active TTS voice sessions per second.
	MessageStoresOfflineCurrent	MessageStoresOfflineCurrent	NULL	A current total of Cisco Unity Message Stores that are offline.
	PortsUsedCurrent	PortsUsedCurrent	NULL	The current number of integration ports that are in use by the Cisco Unity Connection server.
	AverageAuthenticationTime	AverageAuthenticationTime	NULL	Average time taken to authenticate.
	TTSSessionDurationAverage	TTSSessionDurationAverage	NULL	The average duration of all TTS sessions in seconds.
	MessageStoresOnlineCurrent	MessageStoresOnlineCurrent	NULL	A current total of Cisco Unity Message Stores that are online.
	PortsLockedCount	PortsLockedCount	NULL	The current count of the ports that no longer respond or are otherwise unusable by Cisco Unity Connection
	UnityMTAMessageCountCurrent	UnityMTAMessageCountCurrent	NULL	The number of messages currently queued in the MTA(Message Transfer Agent).
	IncomingCallsDurationAverage	IncomingCallsDurationAverage	NULL	The average duration in seconds of all incoming calls to the Cisco Unity Connection server.
	DirectoryResynchronizationDurationAverage	DirectoryResynchronizationDurationAverage	NULL	The average duration of information directory synchronization, in seconds
	PortsIdleDurationAverage	PortsIdleDurationAverage	NULL	The average time that any port remains idle between incoming calls to the Cisco Unity Connection server in seconds.
	OutgoingCallsDurationAverage	OutgoingCallsDurationAverage	NULL	The average duration of all outgoing calls from the Cisco Unity Connection server in seconds.

Agent G2 - Citrix Broker Agent DotNet v4

Description

Monitors Citrix Broker Agent role performance Counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Citrix Broker Agent DotNet v4	citrix.broker.agent.total.sessions	CitrixBrokerAgent TotalSessions	NULL	Total Number of Sessions
	citrix.broker.agent.num.of.registrations	CitrixBrokerAgent NumberofRegistrations	NULL	Total Number of Registrations
	citrix.broker.agent.total.app.sessions	CitrixBrokerAgent TotalAppSessions	NULL	Total Number of Seamless App Sessions
	citrix.broker.agent.total.notifications	CitrixBrokerAgent TotalNotifications	NULL	Total Number of Notifications
	citrix.broker.agent.num.of.deregistrations	CitrixBrokerAgent NumberofDeregistrations	NULL	Total Number of DeRegistrations
	citrix.broker.agent.total.desktops.session	CitrixBrokerAgent TotalDesktopsSession	NULL	Total Number of Desktop Sessions

Agent G2 - Citrix Broker Service DotNet v4

Description

Monitors Citrix Broker Service role performance counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Citrix Broker Service DotNet v4	citrix.broker.service.hard.registrations.per.sec	CitrixBrokerService HardRegistrationsPerSec	NULL	Hard Registrations/sec is the rate at which virtual desktop agents hard-register with Citrix Broker Service

Agent G2 - Citrix Licensing

Description

Template for Citrix Licensing

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Citrix Licensing	Total_License	Total_License	NULL	The sum of the total license count of the citrix concurrent licenses with the common name available in the citrix licensing server.
	License_Usage	License_Usage	NULL	The sum of the license usage number of the citrix concurrent licenses being used currently with the common name.
	License_Used_Percentage	License_Used_Percentage	NULL	License percent used is the percentage of the license usage of the citrix concurrent licenses with the common name in the citrix licensing server.
	License_SA_Expiry_in_days	License_SA_Expiry_in_days	NULL	Provides the number of days remaining to expire subscription advantage (SA) of all the possible licenses of the citrix license server.

Agent G2 - Citrix Licensing Performance Counters

Description

Monitors Citrix Licensing Performance data

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Citrix Licensing Performance Counters	Total_License	Total_License	NULL	The sum of the total license count of the citrix concurrent licenses with the common name available in the citrix licensing server.
	License_Usage	License_Usage	NULL	The sum of the license usage number of the citrix concurrent licenses being used currently with the common name.
	License_Used_Percentage	License_Used_Percentage	NULL	License percent used is the percentage of the license usage of the citrix concurrent licenses with the common name in the citrix licensing server.
	License_SA_Expiry_in_days	License_SA_Expiry_in_days	NULL	Provides the number of days remaining to expire subscription advantage (SA) of all the possible licenses of the citrix license server.

Agent G2 - Citrix Performance Counters DotNet v4

Description

These performance counters should be used to monitor the key performance metrics of the Citrix infrastructure, application servers, and virtual desktops.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Citrix Performance Counters DotNet v4	citrix.percent.processor.time	Citrix Percent Processor Time	%	Percent Processor Time is the percentage of elapsed time that the processor spends to execute a non-Idle thread. It is calculated by measuring the duration of the idle thread is active in the sample interval, and subtracting that time from interval duration. (Each processor has an idle thread that consumes cycles when no other threads are ready to run). This counter is the primary indicator of processor activity, and displays the average percentage of busy time observed during the sample interval. It is calculated by monitoring the time that the service is inactive and subtracting that value from 100 Percent
	citrix.logicaldisk.avg.disksecpertransfer	Citrix LogicalDisk Avg DiskSecPerTransfer	MS	The Average Disk Second counters show the average time in seconds of a transfer from or to a disk.
	citrix.logicaldisk.currentdiskqueuelength	Citrix LogicalDisk CurrentDiskQueueLength	NULL	Current disk queue length provides a primary measure of disk congestion. It is an indication of the number of transactions that are waiting to be processed.
	citrix.logicaldisk.avg.disksecperwrite	Citrix LogicalDisk Avg DiskSecPerWrite	MS	The Average Disk Second counters show the average time in seconds of a write from or to a disk.
	citrix.logicaldisk.percent.disktime	Citrix LogicalDisk Percent DiskTime	%	Percent Disk Time marks how busy the disk is.
	citrix.network.interface.bytestotalpersec	Citrix Network Interface BytesTotalPerSec	NULL	Bytes Total/sec shows the rate at which the network adaptor is processing data bytes. This counter includes all application and file data, in addition to protocol information, such as packet headers.
	citrix.system.processor.queuelength	Citirx System Processor Queue Length	NULL	Processor queue length is the number of threads in the processor queue. Unlike the disk counters, this counter shows ready threads only, not threads that are running. There is a single queue for processor time even on computers with multiple processors. Therefore, if a computer has multiple processors, you need to divide this value by the number of processors servicing the workload. A sustained processor queue of less than ten threads per processor is normally acceptable, dependent of the workload.
	citrix.paging.file.percentusage	Citrix Paging File Percent Usage	NULL	This is the percentage amount of the Page File instance in use.
	citrix.logicaldisk.percent.freespace	Citrix LogicalDisk Percent FreeSpace	%	Percent Free Space is the percentage of total usable space on the selected logical disk drive that is free.
	citrix.memory.available.bytes	Citrix Memory Available Bytes	%	Available memory indicates the amount of memory that is left after nonpaged pool allocations, paged pool allocations, process working sets, and the file system cache have all taken their piece.
	citrix.logicaldisk.avg.disksecperread	Citrix LogicalDisk Avg DiskSecPerRead	MS	The Average Disk Second counters show the average time in seconds of a read from or to a disk.

Agent G2 - Citrix XenApp 7.5 DotNet v4

Description

Monitor Citrix XenApp Server 7.5 version performance counters.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Citrix XenApp 7.5 DotNet v4	Citrix_Conf_Logging_Database_State	Citrix_Conf_Logging_Database_State	NULL	Database Connected indicates whether this service is in contact with its database (1 is connected; 0 is not connected).

Agent G2 - Citrix XenApp 7.6 DotNet v4

Description

Monitor Citrix XenApp Server 7.6 version performance counters.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Citrix XenApp 7.6 DotNet v4	citrix.conf.loggingdatabase.avgtransactiontime	Citirx Conf Logging Database Avg Transaction Time	NULL	The time on average, in seconds, taken to execute a database transaction. A baseline needs to be established in the environment in order to accurately establish threshold values.
	citrix.monitor.database.connected	Citrix Monitor Database Connected	NULL	Database Connected indicates whether this service is in contact with its database (1 is connected; 0 is not connected)
	citrix.conf.loggingdatabase.transactionerrorspersec	Citrix Conf Logging Database Transaction Errors Per sec	NULL	The rate at which database transactions are failing.
	citrix.env.test.database.connected	Citrix Env Test Database Connected	NULL	Database Connected indicates whether this service is in contact with its database (1 is connected; 0 is not connected)

Agent G2 - Citrix XenApp Advanced Performance Check

Description

XenApp Advanced Monitoring

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Citrix XenApp Advanced Performance Check	XADisconnectedSessions	XADisconnectedSessions	Count	Lists sessions in disconnected state. This helps identify if there are any sporadic disconnects from the server.
	XAOfflineServers	XAOfflineServers	Count	A server can be taken offline either for maintenance or because the Server is unstable and is removed from available servers. These servers will not service any user requests.
	XAServerLoad	XAServerLoad	NULL	This monitor displays the load on each Citrix XenApp Servers. These load values can identify issues with your servers in addition to determining which server is the least/most loaded in your farm. A trending value of this monitor helps identify peak usage of the servers. A value greater than 9000 indicates a heavily loaded server
	XAServerApplication	XAServerApplication	Count	Number of applications hosted on each server. This help you decide if the load is distributed evenly across all your servers.
	XASessions	XASessions	Count	Number of active sessions per server.

Agent G2 - Citrix XenApp Performance Check DotNet v4

Description

XenApp Standard Monitoring

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Citrix XenApp Performance Check DotNet v4	LicenseServerConnectionFailure	LicenseServerConnectionFailure	NULL	The number of minutes that the XenApp server has been disconnected from the License Server. The time returned should be less than 30 minutes. Ideally the returned time should be zero.
	WorkItemQueueExecutingCount	WorkItemQueueExecutingCount	NULL	The number of work items that are ready to be executed.
	DataStorewritesPersec	DataStorewritesPersec	NULL	The number of times data was written to the data store per second.
	ZoneElectionsTriggered	ZoneElectionsTriggered	NULL	The number of times a server triggers a zone election.
	STATicketTimeoutCount	STATicketTimeoutCount	NULL	The total number of ticket time-outs that occur during the lifetime of the STA.
	AverageLicenseCheckInResponseTimems	AverageLicenseCheckInResponseTimems	NULL	This component monitor returns the average response time for a license check-in operation in milliseconds.
	LatencySessionDeviation	LatencySessionDeviation	NULL	This component monitor returns the difference between the minimum and the maximum session latency values. This value should be as low as possible.
	BytesReceivedPersec	Bytes Received Per sec	NULL	This component monitor returns the data rate of incoming Independent Management Architecture(IMA) network traffic.
	NetworkConnections	NetworkConnections	NULL	This component monitor returns the number of active network IMA connections to IMA servers.
	LocalHostCachewritesPersec	LocalHostCachewritesPersec	NULL	The number of times data was written to the IMA local host cache per second.
	ResolutionWorkItemQueueExecutingCount	ResolutionWorkItemQueueExecutingCount	NULL	The number of work items that are currently being executed.
	WorkItemQueuePendingCount	WorkItemQueuePendingCount	NULL	The number of work items that are not yet ready to be executed.
	NumberofbusyXMLthreads	NumberofbusyXMLthreads	NULL	The number of busy threads.
	DataStorereadsPersec	DataStorereadsPersec	NULL	The number of times data was read from the data store per second.
	CPUEntitlement	CPUEntitlement	NULL	The percentage of CPU resource that Citrix CPU Utilization Management makes available to a user at a given time.
	CPUUsage	CPUUsage	NULL	The percentage of CPU resource consumed by a user at a given time averaged over a few seconds.
	STAPeakTicketRequestRate	STAPeakTicketRequestRate	NULL	The maximum rate of ticket generation requests per second during the lifetime of the STA.
	LongtermCPUUsage	LongtermCPUUsage	NULL	The percentage of CPU resource consumed by a user averaged over a longer period than the CPU Usage counter.
	ApplicationResolutionsPersec	ApplicationResolutionsPersec	NULL	The number of resolutions completed per second.
	DynamicStorewritesPersec	DynamicStorewritesPersec	NULL	The number of times data was written to the dynamic store per second.
	ApplicationEnumerationsPersec	ApplicationEnumerationsPersec	NULL	Enumeration is the process in which a client transmits data to locate servers on the network and retrieves information about the server farms published applications. During enumeration the XenApp Plug-in for Hosted Apps communicates with the Citrix XML Service or the ICA browser depending on the browsing protocol selected in the plug-in. This monitor provides the number of application enumerations per second.
	DataStoreConnectionFailure	DataStoreConnectionFailure	NULL	The number of minutes that the XenApp server has been disconnected from the data store. This value should be zero at all times.
	LastRecordedLicenseCheckOutResponseTimems	LastRecordedLicenseCheckOutResponseTimems	NULL	The last recorded license check-out response time in milliseconds.
	WorkItemQueueReadyCount	WorkItemQueueReadyCount	NULL	The number of work items that are not yet ready to be executed.
	STAPeakAllRequestRate	STAPeakAllRequestRate	NULL	Secure Ticket Authority (STA) is responsible for issuing session tickets in response to connection requests for published resources on XenApp. These session tickets form the basis of authentication and authorization for access to published resources.
	LatencySessionAverage	LatencySessionAverage	NULL	The average client latency over the lifetime of a session.
	LatencyLastRecorded	LatencyLastRecorded	NULL	This component monitor returns the last recorded latency value of the session.
	ICARoundtripLatencyMedian	ICARoundtripLatencyMedian	NULL	The median time of ICA roundtrip latency for all sessions on the server.
	BytesSentPersec	BytesSentPersec	NULL	This component monitor returns the data rate of outgoing IMA network traffic.
	STAPeakTicketRefreshRate	STAPeakTicketRefreshRate	NULL	The maximum rate of refresh requests per second during the lifetime of the STA.
	ResolutionWorkItemQueueReadyCount	ResolutionWorkItemQueueReadyCount	NULL	The number of work items that are ready to be executed.
	CPUReservation	CPUReservation	NULL	The percentage of total computer CPU resource reserved for a user, should that user require it.
	CPUShares	CPUShares	NULL	The proportion of CPU resource assigned to a user.
	LocalHostCachereadsPersec	LocalHostCachereadsPersec	NULL	The number of times data was read from the IMA local host cache per second.
	MaximumnumberofXMLthreads	MaximumnumberofXMLthreads	NULL	The maximum number of threads allocated to service Web-based sessions since the server restarted.
	AverageLicenseCheckOutResponseTimems	AverageLicenseCheckOutResponseTimems	NULL	This component monitor returns the average response time for a license check-out operation in milliseconds.
	ApplicationResolutionsFailedPersec	ApplicationResolutionsFailedPersec	NULL	The number of application resolutions failed per second.
	DynamicStorereadsPersec	DynamicStorereadsPersec	NULL	The number of times data was read from the dynamic store per second.
	STAPeakDataRequestRate	STAPeakDataRequestRate	NULL	The maximum rate of data requests per second during the lifetime of the STA.
	ZoneElectionsWon	ZoneElectionsWon	NULL	The number of times a server wins a zone election.
	ApplicationResolutionTimems	ApplicationResolutionTimems	ms	The time in milliseconds that a resolution took to complete. A baseline would be needed in order to establish increases during peak logon times before an accurate threshold can be defined.

Agent G2 - Citrix XenDesktop Advanced Performance Check

Description

Citrix XenDesktop advanced monitoring based on performance counters.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Citrix XenDesktop Advanced Performance Check	DesktopsWithRegistrationStateAsAgentError	DesktopsWithRegistrationStateAsAgentError	NULL	Lists all Virtual Desktops which have not registered with the controller due to Agent Error. The state of being in communication is referred to as the VDA being registered with a controller. If communication fails for any reason the VDA is said to have failed to register with a controller and it will not be possible for DDC to broker a connection to the VDM in question; the VDM becomes a wasted resource.
	DesktopsUnRegistered	DesktopsUnRegistered	NULL	Lists all Virtual Desktops in the Unregistered state. The state of being in communication is referred to as the VDA being registered with a controller. If communication fails for any reason the VDA is said to have failed to register with a controller and it will not be possible for DDC to broker a connection to the VDM in question; the VDM becomes a wasted resource.
	DesktopsWithUnknownPowerState	DesktopsWithUnknownPowerState	NULL	The Virtual desktop power state and issuing of power commands to the VM depends on the DDC services being able to communicate with the hypervisor that hosts the VM. The unknown power state is a result of the DDC never having received a notification of the power state of the VM from the hypervisor (hence state unknown).
	DesktopsNeverRegistered	DesktopsNeverRegistered	NULL	Virtual desktop machine which never registered with the Desktop Controllers. An unregistered desktop cannot be used by an end-user.
	TotalDesktops	TotalDesktops	NULL	The total number of desktops in a given Desktop Group.
	BrokerHypervisorAlertSeverityRed	BrokerHypervisorAlertSeverityRed	NULL	Lists the current alerts objects reported by the hypervisors that the controller is monitoring.
	DesktopsFacingICALatency	DesktopsFacingICALatency	NULL	Desktop Receiver on the client PCs communicates with the Virtual Desktop Agent(VDA) on the Virtual Desktops using the ICA (Independent Computing Architecture). High latency on this communication channel would result in slowness/freezing of sessions.
	DesktopsDisconnected	DesktopsDisconnected	NULL	Number of Virtual Desktops whose summary state is in disconnected state.
	DesktopsFacingHighProfileLoadTime	DesktopsFacingHighProfileLoadTime	NULL	Desktop Receiver on the client PCs communicates with the Virtual Desktop Agent(VDA) on the Virtual Desktops using the ICA (Independent Computing Architecture). Profile Load time is directly impacted with the profile size. This results in users experiencing logon delays.
	DesktopsAvailable	DesktopsAvailable	NULL	The number of desktops available in a desktop group.
	DesktopGroupsUsage	DesktopGroupsUsage	NULL	% of virtual desktop machines used within a group.
	DesktopsInUse	DesktopsInUse	NULL	The number of desktops currently in use in a given Desktop Group.
	ActiveSessions	ActiveSessions	NULL	The number of Desktop sessions currently streamed.
	DesktopsinMaintenanceMode	DesktopsinMaintenanceMode	NULL	Putting a desktop in maintenance mode temporarily stops connections to the desktop so that maintenance tasks can be carried out. A user trying to connect to a desktop in maintenance mode will receive a message telling them the desktop is currently unavailable and to try reconnecting. XenDesktop has no control over desktops in maintenance mode. No user can log on to a desktop in this state. If a user is already logged on, maintenance mode takes effect as soon as they log off.
	DesktopsWithImageOutOfDate	DesktopsWithImageOutOfDate	NULL	Shows Desktop Groups that have desktops with Out Of Date Images

Agent G2 - Citrix XenDesktop Performance Counters

Description

Monitors the XenDesktop System, Power status, Available system count, Delivery Group Desktops available count, unregistered count along with the Controller details like State, Services 7 Licensing details etc., Applicable on the XenApp/Xendesktop 7.x versions.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Citrix XenDesktop Performance Counters	broker.desktop.group.desktops.available	BrokerDesktopGroup DesktopsAvailable	%	Number of available desktops
	broker.desktop.group.desktops.disconnected	BrokerDesktopGroup DesktopsDisconnected	%	Number of disconnected desktops
	broker.catalog.available.count	BrokerCatalog AvailableCount	NULL	Number of available systems
	broker.desktop.group.desktops.unregistered	BrokerDesktopGroup DesktopsUnregistered	%	Number of unregistered desktops
	broker.desktop.group.desktops.never.registered	BrokerDesktopGroup Desktops NeverRegistered	%	Number of desktops never registered
	broker.desktop.group.desktops.preparing	BrokerDesktopGroup DesktopsPreparing	%	Number of desktops in preparing state

Agent G2 - Citrix XenDesktop Status and Performance Check DotNet v4

Description

Applicable on XenDesktop - Desktop Delivery Controller

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Citrix XenDesktop Status and Performance Check DotNet v4	RegistrationRequestsPersec	RegistrationRequestsPersec	NULL	Registration Requests/sec is the rate at which Citrix Broker Service receives registration requests from virtual desktops.
	RegistrationAvgRequestTime	RegistrationAvgRequestTime	NULL	Registration Avg. Request Time is the time on average in seconds taken to process a virtual desktop registration request in Citrix Broker Service. This delay is a one time daily expense
	BrokeredSessions	BrokeredSessions	NULL	Brokered Sessions is the number of virtual desktop sessions brokered by the Citrix Broker Service.

Agent G2 - CPU - Run Queue Monitor DotNet v4

Description

Number of threads in queue waiting for processor time. Threshold for this metric is based on the number of processors on the system. Ideal value range from one to three threads per processor.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - CPU - Run Queue Monitor DotNet v4	cpu.run.queue.monitor	CPU Run Queue Monitor	NULL	Number of threads in queue waiting for processor time. Threshold for this metric is based on the number of processors on the system. Ideal value range from one to three threads per processor.

Agent G2 - DB-Oracle DotNet v4

Description

Monitors Oracle Performance Counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - DB-Oracle DotNet v4	Oracle_UserRollbacks	Oracle User Rollbacks	Count	Validates the Number of User Roll backs.
	Oracle_DataFileDiskWrites	Oracle Data File Disk Writes	Count	Validates the Number of Data file disk writes to database.
	Oracle_CacheInvalidations	Oracle Cache Invalidations	Count	Validates the how many Cache invalidations on particular database.
	Oracle_TableSpaceFree	Oracle Table Space Free	MB	Validates free table space available
	Oracle_UsersCommit	Oracle Users Commit	Count	Validates Number of User commits
	Oracle_TableSpaceAllocated	Oracle Table Space Allocated	MB	Validates the Size allocated for the table by database.
	Oracle_Sessions	Oracle Sessions	Count	Validates how many sessions currently on particular database.
	Oracle_DataFileDiskReads	Oracle Data File Disk Reads	Count	Validates the Number of Data file disk reads by database.
	Oracle_LibraryCacheReloads	Oracle Library Cache Reloads	Count	Validates the Number of Library Cache Reloads by database.
	Oracle_DataFilelesizeAllocated	Oracle Data File size Allocated	MB	Validates the Data File Size Allocated for the database.
	Oracle_LibraryCacheGets	Oracle Library Cache Gets	Count	Validates the Number of Library Cache gets by database.
	Oracle_LongRunningQueries	Oracle Long Running Queries	Count	Validates the how many long running queries on particular database.
	Oracle_TablescanBlocks	Oracle Table scan Blocks	Count	Validates the Number of Table scan blocks by database.
	Oracle_BlockingLockQueries	Oracle Blocking Lock Queries	Count	Validates the how many block lock queries on particular database.
	oracle_processes	Oracle Processes	Count	Validates the how many processes on particular database.

Agent G2 - Dell Hardware Health - WMI DotNet v4

Description

Monitors the Dell hardware health parameters like CPU Status, Memory status, Fan status, Fan reading, Temperature status, Temperature reading, Power consumption watts sensor status, Power consumption watts sensor reading, Power consumption amps sensor status, Power consumption amps sensor reading, voltage status and voltage reading.

Prerequisites

Validated on Dell PowerEdge R710, Microsoft Windows Server 2008 R2 Standard Edition Service Pack 1, 64-bit.

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Dell Hardware Health - WMI DotNet v4	dell.voltage.sensor.reading	Voltage Reading	NULL	Dell Voltage sensor current reading in millivolts.
	dell.temperature.reading	Temperature Reading	NULL	Dell Temperature sensor current reading in centigrade.
	dell.power.consumption.ampssensor.reading	Power Consumption Amps Sensor Reading	NULL	Dell Power consumption amps sensor current reading.

Agent G2 - DFS NameSpace Replication Performance Counters DotNet v4

Description

DFS Monitoring - Namespace and Replication Check

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - DFS NameSpace Replication Performance Counters DotNet v4	dfsnamespaceserviceapirequests.requestsprocessed	DFSNamespaceServiceAPIRequests RequestsProcessed	NULL	Requests Processed shows the number of requests to one API that were processed by the DFS Namespace service.
	dfsreplicatedfolders.deletedspaceinuse	DFSReplicatedFolders DeletedSpaceInUse	NULL	Deleted Space in Use shows the total size (in bytes) of the deleted files and folders currently in the Conflict and Deleted folder used by the DFS Replication service. The DFS Replication service detects remote deletes from its sending partner and moves the file or folder to the Conflict and Deleted folder. The service automatically cleans up the Conflict and Deleted folder when it exceeds a pre-configured threshold of the quota.
	dfsreplicatedfolders.deletedfilesgenerated	DFSReplicatedFolders DeletedFilesGenerated	NULL	Deleted Files Generated shows the number of replicated deleted files and folders that were moved to the Conflict and Deleted folder after they were deleted from a replicated folder on a sending member. The DFS Replication service automatically cleans up the Conflict and Deleted folder when it exceeds a pre-configured threshold of the quota.
	dfsreplicationconnections.totalfilesreceived	DFSReplicationConnections TotalFilesReceived	NULL	Total Files Received shows the number of files that were received on the connection.
	dfsreplicatedfolders.conflictfoldercleanupscompleted	DFSReplicatedFolders ConflictFolderCleanupsCompleted	NULL	Conflict Folder Cleanups Completed shows the number of times conflict loser files and folders in the Conflict and Deleted folder were deleted by the DFS Replication service. The DFS Replication service automatically detects and resolves conflicts encountered in replicated folders and moves the losing version to the Conflict and Deleted folder. The service automatically cleans up the Conflict and Deleted folder when it exceeds a pre-configured threshold of the quota.
	dfsreplicationconnections.rdcbytesreceived	DFSReplicationConnections RDCBytesReceived	NULL	RDC Bytes Received shows the bytes that were received on this connection while replicating files using remote differential compression (RDC). This is the actual bytes received over the network without the networking protocol overhead.
	dfsreplicatedfolders.stagingspaceinuse	DFSReplicatedFolders StagingSpaceInUse	NULL	Staging Space In Use shows the total size (in bytes) of the files and folders currently in the staging folder used by the DFS Replication service. This counter will fluctuate as staging space is reclaimed. The DFS Replication service stages files and folders in the staging folder before they are replicated, and automatically cleans up the staging folder when it exceeds a pre-configured threshold of the quota.
	dfsreplicationconnections.sizeoffilesreceived	DFSReplicationConnections SizeofFilesReceived	NULL	Size of Files Received shows the uncompressed size (in bytes) of the files received on this connection. This is the number of bytes that would have been received had DFS Replication compression not been used.
	dfsnamespaceservicereferrals.requestsprocessedpersec	DFSNamespaceServiceReferrals RequestsProcessedPersec	NULL	Requests Per Sec. shows the number of referral requests per second that were processed by the DFS Namespace service.
	dfsreplicationservicevolumes.usnjournalrecordsread	DFSReplicationServiceVolumes USNJournalRecordsRead	NULL	USN Journal Records Read shows the number of update sequence number (USN) journal records that were read by the DFS Replication service.
	dfsreplicatedfolders.deletedbytesgenerated	DFSReplicatedFolders DeletedBytesGenerated	NULL	Deleted Bytes Generated shows the total size (in bytes) of replicated deleted files and folders that were moved to the Conflict and Deleted folder after they were deleted from a replicated folder on a sending member. The DFS Replication service automatically cleans up the Conflict and Deleted folder when it exceeds a pre-configured threshold of the quota.
	dfsreplicatedfolders.stagingfilescleanedup	DFSReplicatedFolders StagingFilesCleanedup	NULL	Staging Files Cleaned up shows the number of files and folders that were cleaned up from the staging folder by the DFS Replication service. The DFS Replication service stages files and folders in the staging folder before they are replicated, and automatically cleans up the staging folder when it exceeds a pre-configured threshold of the quota.
	dfsreplicationconnections.rdcsizeoffilesreceived	DFSReplicationConnections RDCSizeofFilesReceived	NULL	RDC Size of Files Received shows the uncompressed size (in bytes) of files received with remote differential compression (RDC) for this connection. This is the number of bytes that would have been received had neither compression nor RDC been used. This is not the actual number of bytes received over the network.
	dfsreplicatedfolders.conflictspaceinuse	DFSReplicatedFolders ConflictSpaceInUse	NULL	Conflict Space in Use shows the total size (in bytes) of the conflict loser files and folders currently in the Conflict and Deleted folder used by the DFS Replication service. The DFS Replication service automatically detects and resolves conflicts encountered in replicated folders and moves the losing version to the Conflict and Deleted folder. The service automatically cleans up the Conflict and Deleted folder when it exceeds a pre-configured threshold of the quota.
	dfsreplicatedfolders.rdcbytesreceived	DFSReplicatedFolders RDCBytesReceived	NULL	RDC Bytes Received shows the number of bytes that were received in replicating files using remote differential compression (RDC) for this replicated folder. This is the actual bytes received over the network without the networking protocol overhead.
	dfsreplicationconnections.compressedsizeoffilesreceived	DFSReplicationConnections CompressedSizeofFilesReceived	NULL	Compressed Size of Files Received shows the compressed size of files (in bytes) received on the connection.
	dfsreplicatedfolders.conflictbytesgenerated	DFSReplicatedFolders ConflictBytesGenerated	NULL	Conflict Bytes Generated shows the total size (in bytes) of the files and folders in this replicated folder that were moved to the Conflict and Deleted folder by the DFS Replication service. The DFS Replication service automatically detects and resolves conflicts encountered in replicated folders and moves the losing version to the Conflict and Deleted folder. The service automatically cleans up the Conflict and Deleted folder when it exceeds a pre-configured threshold of the quota.
	dfsreplicatedfolders.rdcnumberoffilesreceived	DFSReplicatedFolders RDCNumberofFilesReceived	NULL	RDC Number of Files Received shows the number files that were received for this replicated folder.
	dfsreplicatedfolders.conflictfilescleanedup	DFSReplicatedFolders ConflictFilesCleanedup	NULL	Conflict Files Cleaned up shows the number the conflict loser files and folders that were deleted from the Conflict and Deleted folder by the DFS Replication service. The DFS Replication service automatically detects and resolves conflicts encountered in replicated folders and moves the losing version to the Conflict and Deleted folder. The service automatically cleans up the Conflict and Deleted folder when it exceeds a pre-configured threshold of the quota.
	dfsreplicatedfolders.fileinstallssucceeded	DFSReplicatedFolders FileInstallsSucceeded	NULL	File Installs Succeeded shows the number of files that were successfully received from sending members and installed locally on this server. The DFS Replication service replicates staged files into the staging folder, uncompresses them in the Installing folder, and renames them to the target location. The second and third steps of this process are known as installing the file.
	dfsreplicatedfolders.conflictbytescleanedup	DFSReplicatedFolders ConflictBytesCleanedup	NULL	Conflict Bytes Cleaned up shows the total size (in bytes) of the conflict loser files and folders that were deleted from the Conflict and Deleted folder by the DFS Replication service. The DFS Replication service automatically detects and resolves conflicts encountered in replicated folders and moves the losing version to the Conflict and Deleted folder. The service automatically cleans up the Conflict and Deleted folder when it exceeds a pre-configured threshold of the quota.
	dfsreplicatedfolders.stagingbytescleanedup	DFSReplicatedFolders StagingBytesCleanedup	NULL	Staging Bytes Cleaned up shows the total size (in bytes) of the files and folders that were cleaned up from the staging folder by the DFS Replication service. The DFS Replication service stages files and folders in the staging folder before they are replicated, and automatically cleans up the staging folder when it exceeds a pre-configured threshold of the quota.
	dfsreplicationservicevolumes.databasecommits	DFSReplicationServiceVolumes DatabaseCommits	NULL	Database Commits shows the number of database commit operations performed by the DFS Replication service. This counter indicates how intensive the DFS Replication service is from a database perspective.
	dfsreplicatedfolders.fileinstallsretried	DFSReplicatedFolders FileInstallsRetried	NULL	File Installs Retried shows the number of file installs that are being retried due to sharing violations or other errors encountered when installing the files. The DFS Replication service replicates staged files into the staging folder, uncompresses them in the Installing folder, and renames them to the target location. The second and third steps of this process are known as installing the file.
	dfsreplicatedfolders.stagingfilesgenerated	DFSReplicatedFolders StagingFilesGenerated	NULL	Staging Files Generated shows the number of times replicated files and folders were staged by the DFS Replication service. The DFS Replication service stages files and folders in a staging folder before they are replicated, and automatically cleans up the staging folder when it exceeds a pre-configured threshold of the quota.
	dfsreplicatedfolders.totalfilesreceived	DFSReplicatedFolders TotalFilesReceived	NULL	Total Files Received shows the number of files that were received by this replicated folder.
	dfsnamespaceservicereferrals.requestsprocessed	DFSNamespaceServiceReferrals RequestsProcessed	NULL	Requests Processed shows the number of referral requests that were processed by the DFS Namespace service.
	dfsreplicatedfolders.deletedbytescleanedup	DFSReplicatedFolders DeletedBytesCleanedup	NULL	Deleted Bytes Cleaned up shows the total size (in bytes) of replicating deleted files and folders (in bytes) that were cleaned up from the Conflict and Deleted folder by the DFS Replication service. The service automatically cleans up the Conflict and Deleted folder when it exceeds a pre-configured threshold of the quota.
	dfsreplicatedfolders.rdccompressedsizeoffilesreceived	DFSReplicatedFolders RDCCompressedSizeofFilesReceived	NULL	RDC Compressed Size of Files Received shows the compressed size (in bytes) of the files received with remote differential compression (RDC) for this replicated folder. This is the number of bytes that would have been received had RDC not been used. This is not the actual bytes received over the network.
	dfsreplicationconnections.bytesreceivedpersecond	DFSReplicationConnections BytesReceivedPerSecond	NULL	Bytes Received Per Second shows an estimate of the average number of bytes that were received each second over the past 30 seconds.
	dfsreplicationservicevolumes.usnjournalunreadpercentage	DFSReplicationServiceVolumes USNJournalUnreadPercentage	NULL	USN Journal Unread Percentage shows the percent of the update sequence number (USN) journal that has not yet been read and processed by the DFS Replication service. A journal wrap will occur if this counter reaches 100.
	dfsreplicatedfolders.compressedsizeoffilesreceived	DFSReplicatedFolders CompressedSizeofFilesReceived	NULL	Compressed Size of Files Received shows the compressed size of files (in bytes) received for this replicated folder.
	dfsreplicatedfolders.deletedfilescleanedup	DFSReplicatedFolders DeletedFilesCleanedup	NULL	Deleted Files Cleaned up shows the number of replicated deleted files and folders that were cleaned up from the Conflict and Deleted folder by the DFS Replication service. The service automatically cleans up the Conflict and Deleted folder when it exceeds a pre-configured threshold of the quota.
	dfsnamespaceservicereferrals.requestsfailed	DFSNamespaceServiceReferrals RequestsFailed	NULL	Requests Failed shows the number of referral requests that were failed by the DFS Namespace service.
	dfsreplicatedfolders.updatesdropped	DFSReplicatedFolders UpdatesDropped	NULL	Updates Dropped shows the number of redundant file replication update records that were ignored by the DFS Replication service because they did not change the replicated file or folder. For example, dropped updates can occur when access control lists (ACLs) are overwritten with identical ACLs on a file or folder.
	dfsreplicationconnections.rdccompressedsizeoffilesreceived	DFSReplicationConnections RDCCompressedSizeofFilesReceived	NULL	Compressed Size of Files Received shows the compressed size (in bytes) of files received for this replicated folder.
	dfsnamespaceserviceapirequests.requestsfailed	DFSNamespaceServiceAPIRequests RequestsFailed	NULL	Requests Failed shows the number of requests to one API that were failed by the DFS Namespace service.
	dfsreplicatedfolders.bandwidthsavingsusingdfsreplication	DFSReplicatedFolders BandwidthSavingsUsingDFSReplication	NULL	Bandwidth Savings Using DFS Replication shows the percentage of bandwidth that was saved by the DFS Replication service for this replicated folder using a combination of remote differential compression (RDC) and other compression technologies that minimize network bandwidth. For example, a value of 20 indicates that the DFS Replication service used 20% less bandwidth than it would have used if it had transmitted the entire files uncompressed over the network.
	dfsnamespaceservicereferrals.avgresponsetime	DFSNamespaceServiceReferrals AvgResponseTime	NULL	Avg Response Time shows the average response time to the referral requests that were processed by the DFS Namespace service.
	dfsreplicationconnections.rdcnumberoffilesreceived	DFSReplicationConnections RDCNumberofFilesReceived	NULL	RDC Number of Files Received shows the number files that were received on this connection.
	dfsreplicationconnections.bandwidthsavingsusingdfsreplication	DFSReplicationServiceVolumes BandwidthSavingsUsingDFSReplication	NULL	Bandwidth Savings Using DFS Replication shows the percentage of bandwidth that was saved by the DFS Replication service for this connection using a combination of remote differential compression (RDC) and other compression technologies that minimize network bandwidth use. For example, a value of 20 indicates that the DFS Replication service used 20% less bandwidth than it would have used if it had transmitted the entire files uncompressed over the network.
	dfsnamespaceserviceapirequests.requestsprocessedpersec	DFSNamespaceServiceAPIRequests RequestsProcessedPersec	NULL	Requests Per Sec. Rate shows the number of API requests per second that were processed by the DFS Namespace service.
	dfsreplicationconnections.totalbytesreceived	DFSReplicationConnections TotalBytesReceived	NULL	Total Bytes Received shows the total number of bytes received on the connection. The bytes received value includes file data and replication metadata.
	dfsreplicatedfolders.conflictfilesgenerated	DFSReplicatedFolders ConflictFilesGenerated	NULL	Conflict Files Generated shows the number of files and folders in this replicated folder that were moved to the Conflict and Deleted folder by the DFS Replication service. The DFS Replication service automatically detects and resolves conflicts encountered in replicated folders and moves the losing version to the Conflict and Deleted folder. The service automatically cleans up the Conflict and Deleted folder when it exceeds a pre-configured threshold of the quota.
	dfsreplicationservicevolumes.usnjournalrecordsaccepted	DFSReplicationServiceVolumes USNJournalRecordsAccepted	NULL	USN Journal Records Accepted shows the number of update sequence number (USN) journal records that were processed by the DFS Replication service. The DFS Replication service processes all USN journal records for replicated content on a volume and ignores records for non-replicated files and folders on the volume.
	dfsnamespaceserviceapirequests.avgresponsetime	DFSNamespaceServiceAPIRequests AvgResponseTime	NULL	Avg Response Time shows the average response time to the requests to one API that were processed by the DFS Namespace service.
	dfsnamespace.foldercount	DFSNamespace FolderCount	NULL	Folder count shows the number of DFS folders or links in a namespace.
	dfsreplicatedfolders.sizeoffilesreceived	DFSReplicatedFolders SizeofFilesReceived	NULL	Size of Files Received shows the uncompressed size (in bytes) of the files received for this replicated folder. This is the number of bytes that would have been received had DFS Replication compression not been used.
	dfsreplicatedfolders.rdcsizeoffilesreceived	DFSReplicatedFolders RDCSizeofFilesReceived	NULL	RDC Size of Files Received shows the uncompressed size (in bytes) of the files received with remote differential compression (RDC) for this replicated folder. This is the number of bytes that would have been received had neither compression nor RDC been used. This is not the actual bytes received over the network.
	dfsreplicationservicevolumes.databaselookups	DFSReplicationServiceVolumes DatabaseLookups	NULL	Database Lookups shows the number of database search operations performed by the DFS Replication service This counter indicates how intensive the DFS Replication service is from a database perspective.
	dfsreplicatedfolders.stagingbytesgenerated	DFSReplicatedFolders StagingBytesGenerated	NULL	Staging Bytes Generated shows the total size (in bytes) of replicated files and folders in the staging folder created by the DFS Replication service since last restart and is monotonically increasing counter. The DFS Replication service stages files and folders in the staging folder before they are replicated, and automatically cleans up the staging folder when it exceeds a pre-configured threshold of the quota.

Agent G2 - Disk Performance Monitoring DotNet v4

Description

Disk Performance Monitoring

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Disk Performance Monitoring DotNet v4	AverageDiskWriteQueueLength	AverageDiskWriteQueueLength	NULL	Avg. Disk Write Queue Length is the average number of write requests that were queued for the selected disk during the sample interval.
	AvgDisksecPerRead	AvgDisksecPerRead	NULL	Avg. Disk sec/Read is the average time, in seconds, of a read of data from the disk.
	PercentDiskTime	PercentDiskTime	NULL	% Disk Time is the percentage of elapsed time that the selected disk drive was busy servicing read or write requests.
	AverageDiskReadQueueLength	AverageDiskReadQueueLength	NULL	Avg. Disk Read Queue Length is the average number of read requests that were queued for the selected disk during the sample interval.
	AvgDisksecPerWrite	AvgDisksecPerWrite	NULL	Avg. Disk sec/Write is the average time, in seconds, of a write of data to the disk.
	AvgDiskBytesPerTransfer	AvgDiskBytesPerTransfer	NULL	Avg. Disk Bytes/Transfer is the average number of bytes transferred to or from the disk during write or read operations. The disk is efficient if it transfers large amounts of data relatively quickly.
	AverageDiskQueueLength	AverageDiskQueueLength	NULL	Avg. Disk Queue Length is the average number of both read and write requests that were queued for the selected disk during the sample interval.

Agent G2 - DNS Performance Counters DotNet v4

Description

Monitors DNS performance counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - DNS Performance Counters DotNet v4	dns.dynamic.update.requests.received	DNS DynamicUpdateRequestsReceived	NULL	Dynamic Update Received is the total number of dynamic update requests received by the DNS server.
	dns.total.queries.received.per.sec	DNS TotalQueriesReceivedPerSec	NULL	Total Query Received/sec is the average number of queries received by DNS server in each second.
	dns.dynamic.update.requests.empty.persec	DNS DynamicUpdateRequestsEmptyPerSec	NULL	Dynamic Update NoOperation/sec is the average number of No-operation/Empty dynamic update requests received by the DNS server in each second.
	dns.nb.stat.memory.used	DNS NbStatMemoryUsed	NULL	Nbstat Memory is the total Nbstat memory used by DNS server.
	dns.udp.queries.received.per.sec	DNS UDPQueriesReceivedPerSec	NULL	UDP Query Received/sec is the average number of UDP queries received by DNS server in each second.
	dns.zone.transfers.success	DNS ZoneTransfersSuccess	NULL	Zone Transfer Success is the total number of successful zone transfers of the master DNS server.
	dns.tcp.queries.received.per.sec	DNS TCPQueriesReceivedPerSec	NULL	TCP Query Received/sec is the average number of TCP queries received by DNS server in each second.
	dns.caching.memory.used	DNS CachingMemoryUsed	NULL	Caching Memory is the total caching memory used by DNS server.
	dns.secure.updates.failed	DNS SecureUpdatesFailed	NULL	Secure Update Failure is the total number of secure updates failed of the DNS server.
	dns.tcp.message.memory.used	DNS TCPMessageMemoryUsed	NULL	TCP Message Memory is the total TCP message memory used by DNS server.
	dns.database.node.memory.used	DNS DatabaseNodeMemoryUsed	NULL	Database Node Memory is the total database node memory used by DNS server.
	dns.dynamic.update.requests.rejected	DNS DynamicUpdateRequestsRejected	NULL	Dynamic Update Rejected is the total number of dynamic updates rejected by the DNS server.
	dns.dynamic.updates.written.to.database	DNS DynamicUpdateswrittentodatabase	NULL	Dynamic Update Written to Database is the total number of dynamic updates written to the database by the DNS server.
	dns.secure.update.requests.received	DNS SecureUpdateRequestsReceived	NULL	Secure Update Received is the total number of secure update requests received by the DNS server.
	dns.udp.responses.sent.per.sec	DNS UDPResponsesSentPerSec	NULL	UDP Response Sent/sec is the average number of UDP reponses sent by DNS server in each second.
	dns.udp.message.memory.used	DNS UDPMessageMemoryUsed	NULL	UDP Message Memory is the total UDP message memory used by DNS server.
	dns.record.flow.memory.used	DNS RecordFlowMemoryUsed	NULL	Record Flow Memory is the total record flow memory used by DNS server.
	dns.tcp.responses.sent.per.sec	DNS TCPResponsesSentPerSec	NULL	TCP Response Sent/sec is the average number of TCP reponses sent by DNS server in each second.
	dns.zone.transfers.failed	DNS ZoneTransfersFailed	NULL	Zone Transfer Failure is the total number of failed zone transfers of the master DNS server.
	dns.total.responses.sent.per.sec	DNS TotalResponsesSentPerSec	NULL	Total Response Sent/sec is the average number of reponses sent by DNS server in each second.
	dns.dynamic.update.timeouts	DNS DynamicUpdateTimeouts	NULL	Dynamic Update TimeOuts is the total number of dynamic update timeouts of the DNS server.

Agent G2 - DNS Recursive Performance Counters DotNet v4

Description

Monitors DNS Recursive Class WMI Performance data

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - DNS Recursive Performance Counters DotNet v4	DNS_RecursiveTimeOutPerSec	DNS_RecursiveTimeOutPerSec	NULL	Provides the average number of recursive query sending timeouts in each second.
	DNS_RecursiveQueryFailurePerSec	DNS_RecursiveQueryFailurePerSec	NULL	Provides the average number of recursive query failures in each second.
	DNS_RecursiveQueriesPerSec	DNS_RecursiveQueriesPerSec	NULL	Provides the average number of recursive queries received by DNS server in each second.

Agent G2 - Fujitsu PRIMERGY Health - Windows

Description

Monitor the following metrics for Fujitsu PRIMERGY Health on Windows servers: fujitsu_primergy_host_raidController_healthState, fujitsu_primergy_host_raidController_primaryStatus, fujitsu_primergy_diskDrive_healthState, fujitsu_primergy_diskDrive_primaryStatus, fujitsu_primergy_temperature_healthState, fujitsu_primergy_temperature_currentState, fujitsu_primergy_temperature_currentReading, fujitsu_primergy_voltage_healthState, fujitsu_primergy_voltage_currentState, fujitsu_primergy_voltage_currentReading, fujitsu_primergy_powerSupply_healthState, fujitsu_primergy_powerConsumptionSensor_healthState, fujitsu_primergy_powerConsumptionSensor_currentState, fujitsu_primergy_fan_healthState, fujitsu_primergy_fan_sensor_healthState, fujitsu_primergy_fan_sensor_currentState, fujitsu_primergy_fan_sensor_currentReading, fujitsu_primergy_managementController_healthState, fujitsu_primergy_processor_healthState, fujitsu_primergy_memory_healthState, fujitsu_primergy_cache_memory_healthState, fujitsu_primergy_physical_memory_healthState

Note: This template will be applicable only for the Agent version 14.0.0 or later.

Prerequisites

This template will be applicable only for the Agent version 14.0.0 or later.

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - Mongos Monitors	mongos.chunks	Mongos Chunks	NULL	Total number of mongos chunks
	mongos.chunks.balance	Mongos Chunks Balance	NULL	Provides Mongos chunks balance between database and collections
	mongos.shards	Mongos Shards	NULL	Total number of mongos shards
	mongos.collections	Mongos Collections	NULL	Total number of mongos sharded collections

Agent G2 - Linux - MySQL Advanced Monitors

Description

It monitors the mysql.Innodb_log_waits, mysql.long_running_procs, and mysqlindex_usage metrics.

Prerequisites

Provide database names as input arguments separated by commas when applying the template at the device level.

Syntax: DBName1,DBName2

Parameters

Name	Description	Default value
MySQL DBname	Dbnames to collect the metric data	NA
MySQL IPAddress	IPAddress of the server where mysql is running	127.0.0.1
MySQL Password	Password of the given username	NA
MySQL Port	Port on which mysql is running	3306
MySQL Username	Username to connect to mysql	NA

Note: All field attributes are mandatory. Please use default values wherever applicable.

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - MySQL Advanced Monitors	mysql.Innodb_log_waits	Mysql Innodb log waits	NULL	The number of times that the log buffer was too small, and a wait was required for it to be flushed before continuing.
	mysql.long_running_procs	Mysql long running process	NULL	Total running process longer than 1 minute in a specific db.
	mysqlindex_usage	Mysql Index Usage	NULL	The sum of index lengths for the tables within the specified database.

Agent G2 - Linux - MySQL Global Performance Statistics

Description

Monitoring template for MySQL application. Monitors command statistics, select statistics, slave status, threads, etc.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - MySQL Global Performance Statistics	mysql.traffic	MySQL-Traffic	NULL
	mysql.threads_connected	MySQL-ThreadsConnected	NULL	The number of currently open connections.
	mysql.command_statistics	MySQL-CommandStatistics	NULL
	mysql.select_statistics	MySQL-SelectStatistics	NULL
	mysql.slave_status	MySQL-SlaveStatus	NULL	If a database has replication configured, then this monitor checks the status of the slave instance which is returned by the command SHOW SLAVE STATUS. It also checks the number of seconds the slave is behind the master and if IO and SQL is running on the slave
	mysql.threads	MySQL-Threads	NULL	Cached threads - The number of threads in the thread cache. Connected threads - The number of currently open connections. Running threads- The number of threads that are not sleeping.

Agent G2 - Linux - MySQL InnoDB Statistics

Description

Monitoring template for MySQL InnoDB application statistics. Monitors InnoDB buffer pool hit rate, buffer pool pages data, buffer pool pages dirty, etc.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - MySQL InnoDB Statistics	mysql.inno.db_buffer_pool_pages_free	MySQL-InnoDBBufferPoolPagesFree	NULL	The number of free pages.
	mysql.inno.db_data_read	MySQL-InnoDBDataRead	NULL	The amount of data read since the server was started.
	mysql.inno.db_buffer_pool_pages_flushed	MySQL-InnoDBBufferPoolPagesFlushed	NULL	The number of buffer pool page-flush requests.
	mysql.inno.db_log_flushed_upto	MySQL-InnoDBLogFlushedUpto	NULL	Log flushed up to.
	mysql.mutex_spin_waits	MySQL-MutexSpinWaits	NULL	Semaphores-Mutex Spin Waits.
	mysql.inno.db_data_writes	MySQL-InnoDBDataWrites	NULL	The total number of data writes.
	mysql.inno.db_buffer_pool_hit_rate	MySQL-InnoDBBufferPoolHitRate	NULL	Buffer Pool hit rate.
	mysql.inno.db_data_written	MySQL-InnoDBDataWritten	NULL	The amount of data written so far, in bytes.
	mysql.inno.db_row_lock_time	MySQL-InnoDBRowLockTime	NULL	The total time spent in acquiring row locks, in milliseconds.
	mysql.log_sequence_number	MySQL-LogSequenceNumber	NULL	Log Sequence number.
	mysql.queries_inside_innodb_core	MySQL-QueriesInsideInnoDBCore	NULL	Row Operations - Queries inside InnoDB core.
	mysql.inno.dbio_capacity	MySQL-InnoDBIOCapacity	NULL
	mysql.inno.db_transaction_history_length	MySQL-InnoDBTransactionHistoryLength	NULL
	mysql.inno.db_flush_log_at_trx_commit	MySQL-InnoDBFlushLogAtTRXCommit	NULL
	mysql.inno.db_buffer_pool_pages_misc	MySQL-InnoDBBufferPoolPagesMisc	NULL	The number of pages that are busy because they have been allocated for administrative overhead such as row locks or the adaptive hash index.
	mysql.inno.db_queries_queue	MySQL-InnoDBQueriesQueue	NULL	Row Operations - Queries in queue.
	mysql.inno.db_row_lock_waits	MySQL-InnoDBRowLockWaits	NULL	The number of times a row lock had to be waited for.
	mysql.inno.db_data_reads	MySQL-InnoDBDataReads	NULL	The total number of data reads.
	mysql.open_read_views_inside_innodb_core	MySQL-OpenReadViewsInsideInnoDBCore	NULL	Row Operations - Read views open inside InnoDB.
	mysql.mutex_spin_rounds	MySQL-MutexSpinRounds	NULL	Semaphores-Mutex Spin Rounds.
	mysql.inno.db_buffer_pool_pages_data	MySQL-InnoDBBufferPoolPagesData	NULL	The number of pages containing data (dirty or clean).
	mysql.inno.db_buffer_pool_pages_dirty	MySQL-InnoDBBufferPoolPagesDirty	NULL	The number of pages currently dirty.
	mysql.inno.db_log_last_check_point	MySQL-InnoDBLogLastCheckPoint	NULL	Log Last check point.
	mysql.inno.db_buffer_pool_read_requests	MySQL-InnoDBBufferPoolReadRequests	NULL	The number of logical read requests InnoDB has done.
	mysql.inno.db_non_hash_searches	MySQL-InnoDBNonHashSearches	NULL	Non-Hash Searches.
	mysql.inno.db_hash_searches	MySQL-InnoDBHashSearches	NULL	Hash Searches.
	mysql.inno.db_force_recovery	MySQL-InnoDBForceRecovery	NULL	Crash recovery mode, the possible values are 0-6: Normal Startup(0), Server Starts even if it detects a corrupt page(1), Prevent Master Thread from running(2), No Transaction Rollbacks after crash recovery(3), Prevent insert buffer merge Operations(4), Ignores undo logs-InnoDB treats incomplete Transactions as Committed(5), Ignores Redo log roll-forward in connection with recovery.(6).
	mysql.inno.db_buffer_pool_size	MySQL-InnoDBBufferPoolSize	NULL	The size in bytes of the memory buffer InnoDB uses to cache data and indexes of its tables. The default value is 8MB. The larger you set this value, the less disk I/O is needed to access data in tables.
	mysql.inno.db_data_fsyncs	MySQL-InnoDBDataFSyncs	NULL	The number of fsync operations so far.
	mysql.inno.db_buffer_pool_reads	MySQL-InnoDBBufferPoolReads	NULL	The number of logical reads that InnoDB could not satisfy from the buffer pool, and had to read directly from the disk.
	mysql.inno.db_log_file_size	MySQL-InnoDBLogFileSize	NULL	The size in bytes of each log file in a log group. The combined size of log files must be less than 4GB. The default value is 5MB. Sensible values range from 1MB to 1/N-th of the size of the buffer pool, where N is the number of log files in the group.
	mysql.mutex_os_waits	MySQL-MutexOSWaits	NULL	Semaphores-Mutex OS Waits.
	mysql.inno.db_buffer_pool_pages_total	MySQL-InnoDBBufferPoolPagesTotal	NULL	The total size of the buffer pool, in pages.
	mysql.inno.db_log_buffer_size	MySQL-InnoDBLogBufferSize	NULL	The size in bytes of the buffer that InnoDB uses to write to the log files on disk. The default value is 1MB for the built-in InnoDB, 8MB for InnoDB Plugin. Sensible values range.

Agent G2 - Linux - MySQL Monitors

Description

Monitoring template for MySQL application. Monitors command statistics, select statistics, slave status, threads, etc.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - MySQL Monitors	mysql.traffic	MySQL-Traffic	NULL
	mysql.threads_connected	MySQL-ThreadsConnected	NULL	The number of currently open connections.
	mysql.command_statistics	MySQL-CommandStatistics	NULL
	mysql.select_statistics	MySQL-SelectStatistics	NULL
	mysql.slave_status	MySQL-SlaveStatus	NULL	If a database has replication configured, then this monitor checks the status of the slave instance which is returned by the command SHOW SLAVE STATUS. It also checks the number of seconds the slave is behind the master and if IO and SQL is running on the slave
	mysql.threads	MySQL-Threads	NULL	Cached threads - The number of threads in the thread cache. Connected threads - The number of currently open connections. Running threads- The number of threads that are not sleeping.

Agent G2 - Linux - MySQL Variable Statistics

Description

Monitoring template for MySQL application statistics. Monitors aborted clients, aborted connects, command statistics, foreign key checks, log warnings, etc.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - MySQL Variable Statistics	mysql.threads_created	MySQL-ThreadsCreated	NULL	The number of threads created to handle connections.
	mysql.query_cache_free_memory	MySQL-QueryCacheFreeMemory	NULL	The amount of free memory for the query cache.
	mysql.max_heap_table_size	MySQL-MaxHeapTableSize	NULL	This variable sets the maximum size to which user-created MEMORY tables are permitted to grow. The value of the variable is used to calculate MEMORY table MAX_ROWS values.
	mysql.threads_cached	MySQL-ThreadsCached	NULL	The number of threads in the thread cache.
	mysql.traffic	MySQL-Traffic	NULL
	mysql.long_query_time	MySQL-LongQueryTime	NULL	If a query takes longer than this many seconds, the server increments the Slow_queries status variable.
	mysql.tmp_table_size	MySQL-TMPTableSize	NULL	The maximum size of internal in-memory temporary tables. If an in-memory temporary table exceeds the limit, MySQL automatically converts it to an on-disk MyISAM table.
	mysql.queries	MySQL-Queries	NULL
	mysql.aborted_connects	MySQL-AbortedConnects	NULL	The number of failed attempts to connect to the MySQL server.
	mysql.query_cache_size	MySQL-QueryCacheSize	NULL	Max amount of data that can be stored in the cache.
	mysql.select_statistics	MySQL-SelectStatistics	NULL
	mysql.threads_running	MySQL-ThreadsRunning	NULL	The number of threads that are not sleeping.
	mysql.query_cache_total_blocks	MySQL-QueryCacheTotalBlocks	NULL	The total number of blocks in the query cache.
	mysql.query_cache_free_blocks	MySQL-QueryCacheFreeBlocks	NULL	The number of free memory blocks in the query cache.
	mysql.max_used_connections	MySQL-MaxUsedConnections	NULL	Max number of connections that have been in use simultaneously since the server started.
	mysql.query_cache_low_memory_purnes	MySQL-QueryCacheLowMemoryPurnes	NULL	The number of queries that were deleted from the query cache because of low memory.
	mysql.slave_status	MySQL-SlaveStatus	NULL	If a database has replication configured, then this monitor checks the status of the slave instance which is returned by the command SHOW SLAVE STATUS. It also checks the number of seconds the slave is behind the master and if IO and SQL is running on the slave.
	mysql.thread_cache_size	MySQL-ThreadCacheSize	NULL	How many threads the server should cache for reuse. When a client disconnects, the client's threads are put in the cache if there are fewer than this monitor value.
	mysql.query_cache_not_cached	MySQL-QueryCacheNotCached	NULL	The number of noncached queries.
	mysql.query_cache_inserts	MySQL-QueryCacheInserts	NULL	The number of queries added to the query cache.
	mysql.table_definition_cache	MySQL-TableDefinitionCache	NULL	The number of table definitions (from .frm files) that can be stored in the definition cache.
	mysql.log_warnings	MySQL-LogWarnings	NULL	Whether to produce additional warning messages. It is enabled (1) by default and can be disabled by setting it to 0.
	mysql.aborted_clients	MySQL-AbortedClients	NULL	The number of connections that were aborted because the client died without closing the connection properly.
	mysql.query_cache_queries_in_cache	MySQL-QueryCacheQueriesInCache	NULL	The number of queries registered in the query cache.
	mysql.threads_connected	MySQL-ThreadsConnected	NULL	The number of currently open connections.
	mysql.foreign_key_checks	MySQL-ForeignKeyChecks	NULL	By default foreign key constraints for InnoDB tables are checked and the value will be 1. If set to 0, they are ignored. Disabling foreign key checking can be useful for reloading InnoDB tables in an order different from that required by their parent/child relationships.
	mysql.query_cache_hits	MySQL-QueryCacheHits	NULL	The number of query cache hits.
	mysql.open_table_cache	MySQL-OpenTableCache	NULL	The number of open tables for all threads.
	mysql.max_user_connections	MySQL-MaxUserConnections	NULL	Max number of simultaneous connections permitted to any given MySQL user. Default value is 0 (no limit).
	mysql.command_statistics	MySQL-CommandStatistics	NULL
	mysql.thread_stack_size	MySQL-ThreadStackSize	NULL	The stack size for each thread. Many of the limits detected by the crash-me test are dependent on this value.

Agent G2 - Linux - NFS Stats Monitors

Description

Agent G2 - Linux - NFS Stats Monitors

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - NFS Stats Monitors	nfs.lookup.ops	NFS Lookup Operations	NULL	The number of lookup operations per second issued to the filesystem.
	nfs.lookup.exe	NFS Lookup Op Request Execution Time	NULL	The duration from the time that NFS client does the RPC lookup request to its kernel until the RPC request is completed, this includes the RTT time above.
	nfs.server.write.mbytes	NFS Server Written Data	NULL	The number megabytes written to the NFS server by the NFS client via an NFS WRITE request.
	nfs.read.retransmissions	NFS Read Retransmissions	NULL	The number of retransmissions.
	nfs.write.rtt	NFS Write Op Request RTT Time	NULL	The duration from the time that client kernel sends the RPC write request until the time it receives the reply.
	nfs.read.ops	NFS Read Operations	NULL	The number of read operations per second issued to the filesystem.
	nfs.lookup.retransmissions	NFS Lookup Retransmissions	NULL	The number of retransmissions.
	nfs.lookup.kbytes	NFS Lookup Op Data	NULL	The amount of lookup data, in kB, per second.
	nfs.write.ops	NFS Write Operations	NULL	The number of write operations per second issued to the filesystem.
	nfs.directory.lookups	NFS Directory Lookups	NULL	The number of name lookups in directories there have been.
	nfs.write.kbytes	NFS Write Op Data	NULL	The amount of data, in kB, written per second.
	nfs.app.write.mbytes	NFS Application Written Data	NULL	The number of megabytes written by applications using the NFS mounted filesystem with the write(2) system call.
	nfs.app.write.direct.mbytes	NFS Application Written (O_DIRECT) Data	NULL	The number of megabytes written to files opened with the O_DIRECT flag.
	nfs.backlog	NFS Backlog	NULL	The length of the backlog queue.
	nfs.read.kbytes	NFS Read Op Data	NULL	The amount of data, in kB, read per second.
	nfs.server.read.mbytes	NFS Server Read Data	NULL	The number megabytes read from the NFS server by the NFS client via an NFS READ request.
	nfs.lookup.rtt	NFS Lookup Op Request RTT Time	NULL	The duration from the time that client kernel sends the RPC lookup request until the time it receives the reply.
	nfs.open.operations	NFS Open Operations	NULL	The number of times files or directories have been opened.
	nfs.write.size	NFS Write Op Data Size	NULL	The average number of kB written per each operation.
	nfs.write.exe	NFS Write Op Request Execution Time	NULL	The duration from the time that NFS client does the RPC write request to its kernel until the RPC request is completed, this includes the RTT time above.
	nfs.read.size	NFS Read Op Data Size	NULL	The average number of kB read per each operation.
	nfs.app.read.mbytes	NFS Application Read Data	NULL	The number of megabytes read by applications using the NFS mounted filesystem with the read(2) system call.
	nfs.ops	NFS Operations	NULL	The number of operations per second issued to the filesystem.
	nfs.age	NFS Mount Age	NULL	The duration of time that the share was mounted in minutes.
	nfs.lookup.size	NFS Lookup Op Data Size	NULL	The average amount of data size in kB for each lookup operation.
	nfs.rpc.badxids	NFS RPC Bad XIDs	NULL	The number of unmatchable XIDs that have been received.
	nfs.read.rtt	NFS Read Op Request RTT Time	NULL	The duration from the time that client kernel sends the RPC read request until the time it receives the reply.
	nfs.app.read.direct.mbytes	NFS Application Read(O_DIRECT) Data	NULL	The number of megabytes read from files opened with the O_DIRECT flag.
	nfs.read.exe	NFS Read Op Request Execution Time	NULL	The duration from the time that NFS client does the RPC read request to its kernel until the RPC request is completed, this includes the RTT time above.
	nfs.write.retransmissions	NFS Write Retransmissions	NULL	The number of retransmissions.

Agent G2 - Linux Network Interface

Description

Prerequisites

Supported Metrics

Metric Name	Metric Display Name	Metric Description	Unit
Agent G2 - Linux Network Interface	system_linux_network_interface_trafficIn	System Linux Network Interface TrafficIn	Monitors the incoming network traffic on a Linux network interface. It indicates the amount of data received by the interface.	Kbps
	system_linux_network_interface_trafficOut	System Linux Network Interface TrafficOut	Monitors the outgoing network traffic on a Linux network interface. It indicates the amount of data transmitted by the interface.	Kbps
	system_linux_network_interface_packetsIn	System Linux Network Interface PacketsIn	Monitors the incoming network packets (number of packets) on a Linux network interface. It counts the number of packets received by the interface.	packets/sec
	system_linux_network_interface_packetsOut	System Linux Network Interface PacketsOut	Monitors the outgoing network packets (number of packets) on a Linux network interface. It counts the number of packets transmitted by the interface.	packets/sec
	system_linux_network_interface_errorsIn	System Linux Network Interface ErrorsIn	Monitors the incoming network errors (number of errors) on a Linux network interface. It counts the number of errors encountered while receiving data.	Errors per Sec
	system_linux_network_interface_errorsOut	System Linux Network Interface ErrorsOut	Monitors the outgoing network errors (number of errors) on a Linux network interface. It counts the number of errors encountered while transmitting data.	Errors per Sec
	system_linux_network_interface_discardsIn	System Linux Network Interface DiscardsIn	Monitors the incoming discarded network packets (number of discarded packets) on a Linux network interface. It counts the number of packets that were discarded upon receipt.	psec
	system_linux_network_interface_discardsOut	System Linux Network Interface DiscardsOut	Monitors the outgoing discarded network packets (number of discarded packets) on a Linux network interface. It counts the number of packets that were discarded upon transmission.	psec
	system_linux_network_interface_operationalState	System Linux Network Interface OperationalState	Monitors operational state of a Linux network interface. It typically provides information such as whether the interface is up or down.	NA
	system_linux_network_interface_outputQueueLength	System Linux Network Interface OutputQueueLength	Monitors the length of the output queue on a Linux network interface. It indicates the number of packets queued up for transmission.	count

Agent G2 - Linux Network Interface - v2

Description

Monitors the performance and status of network interfaces on Linux systems. It captures and analyzes ten essential metrics, including traffic, packet rates, errors, discards, operational states, and output queue lengths, interface utilizations. Interface utilization exceeding 100% can occur due to short-term bursts of traffic, measurement intervals capturing peak activity, or aggregation of multiple interfaces' capacities. In version 2 of the template we added 3 new metrics to monitor received, transmitted and total utilizations. This template only works on Agent version 14.0.0 or later.

Template Usage Guidelines

While applying this template on the device, users need to provide specific input parameters in below two formats only(Case-Insensitive) -

Format 1: Interfaces to monitor: All
(This format monitors all network interfaces present in /sys/class/net excuding the loopback interface)

Format 2: Interfaces to monitor: Interface1,interface2,interface3
(This format monitors only given interfaces)

Prerequisites

Agent version 14.0.0 or later.

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux Network Interface - v2	system_linux_network_interface_trafficIn	System Linux Network Interface TrafficIn	Kbps	Monitors the incoming network traffic on a Linux network interface. It indicates the amount of data received by the interface.
	system_linux_network_interface_trafficOut	System Linux Network Interface TrafficOut	Kbps	Monitors the outgoing network traffic on a Linux network interface. It indicates the amount of data transmitted by the interface.
	system_linux_network_interface_packetsIn	System Linux Network Interface PacketsIn	packets/sec	Monitors the incoming network packets (number of packets) on a Linux network interface. It counts the number of packets received by the interface.
	system_linux_network_interface_packetsOut	System Linux Network Interface PacketsOut	packets/sec	Monitors the outgoing network packets (number of packets) on a Linux network interface. It counts the number of packets transmitted by the interface.
	system_linux_network_interface_errorsIn	System Linux Network Interface ErrorsIn	Errors per Sec	Monitors the incoming network errors (number of errors) on a Linux network interface. It counts the number of errors encountered while receiving data.
	system_linux_network_interface_errorsOut	System Linux Network Interface ErrorsOut	Errors per Sec	Monitors the outgoing network errors (number of errors) on a Linux network interface. It counts the number of errors encountered while transmitting data.
	system_linux_network_interface_discardsIn	System Linux Network Interface DiscardsIn	psec	Monitors the incoming discarded network packets (number of discarded packets) on a Linux network interface. It counts the number of packets that were discarded upon receipt.
	system_linux_network_interface_discardsOut	System Linux Network Interface DiscardsOut	psec	Monitors the outgoing discarded network packets (number of discarded packets) on a Linux network interface. It counts the number of packets that were discarded upon transmission.
	system_linux_network_interface_operationalState	System Linux Network Interface OperationalState	NA	Monitors operational state of a Linux network interface. It typically provides information such as whether the interface is up or down.
	system_linux_network_interface_outputQueueLength	System Linux Network Interface OutputQueueLength	count	Monitors the length of the output queue on a Linux network interface. It indicates the number of packets queued up for transmission.
	system_linux_network_interface_utilization_received	System Linux Network Interface Utilization Received	Percentage(%)	Monitors the incoming network traffic utilization on a Linux network interface.
	system_linux_network_interface_utilization_transmitted	System Linux Network Interface Utilization Transmitted	Percentage(%)	Monitors the outgoing network traffic utilization on a Linux network interface.
	system_linux_network_interface_utilization_total	System Linux Network Interface Utilization Total	Percentage(%)	Monitors the total network traffic utilization of a Linux network interface.

Agent G2 - Linux NFS Mount Point Monitoring - v5

Description

Monitors the Linux NFS mount points availability, accessibility, and utilization. In Version 5 of the template, we introduced enhanced functionality to exclude specific users given in input while checking mount point writability. Additionally, users now have the flexibility to choose between monitoring all mounts or exclusively focusing on permanent mount points(i.e. only nfs mounts present in /etc/fstab).Pre-Requisites: NFS needs to be installed and 1 or more NFS Mount points should be available on target device. Agent must be installed as root.

Template Usage Guidelines

While applying this template on the device, users need to provide specific input parameters in below two formats only(Case-Insensitive) -

Format 1: MountType:All;ExcludedUsers:nobody,nfsnobody,anon
(This format monitors both temporary and permanent mount points, this is the default value)

Format 2: MountType:Permanent;ExcludedUsers:nobody,nfsnobody,anon
(This format monitors only Permanent Mounts which are available in \etc\fstab file)

Prerequisites

NFS needs to be installed and NFS Mount points should be available on target device. Agent must be installed as root.

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux NFS Mount Point Custom Monitor - v5	system_linux_nfs_mountpoint_utilization	System Linux NFS Mountpoint Utilization	Percentage	Monitors the NFS Mount points utilization.
	system_linux_nfs_mountpoint_accessibility	System Linux NFS Mountpoint Accessibility	-	Monitors the accessibility of NFS Mount points. An accessible NFS mount point typically means both read and write access(marked as "0" in output), and inaccessibility (marked as "1" in output) often means it's not writable.
	system_linux_nfs_mountpoint_availability	System Linux NFS Mountpoint Availability	-	Monitors the availability of NFS Mount points. The availability status of mount points is often determined by checking whether the NFS mount point is present in the current list of NFS shares compared to the list stored in the previous state. If a mount point was present in the previous state but is not in the current state, it is marked as "1" (not available). If it is present in both states, it is marked as "0" (available).

Agent G2 - Linux NFS Mount Point Monitoring - v4

Description

Monitors the Linux NFS mount points availability, accessibility, and utilization.In Version 4 of the template, we introduced enhanced functionality to monitor user-specific mounts accessibility. Additionally, users now have the flexibility to choose between monitoring all mounts or exclusively focusing on permanent mount points (i.e. only nfs mounts present in /etc/fstab).

Template Usage Guidelines:

While applying this template on the device, users need to provide specific input parameters in below two formats only (Case-Insensitive).

Format 1: All (This format monitors both temporary and permanent mount points)
Format 2: Permanent (This format monitors only Permanent Mounts which are available in \etc\fstab file)

Prerequisites

NFS needs to be installed and NFS Mount points should be available on target device.

Supported Metric

Monitor Name	Monitor Description	Metric Name	Metric Display Name	Unit	Metric Description
Agent G2 - Linux NFS Mount Point Custom Monitor - v4	Monitors the Linux NFS mount points availability, accessibility, and utilization	system_linux_nfs_mountpoint_utilization	System Linux NFS Mountpoint Utilization	Percentage	Monitors the NFS Mount points utilization.
		system_linux_nfs_mountpoint_accessibility	System Linux NFS Mountpoint Accessibility		Monitors the accessibility of NFS Mount points. An accessible NFS mount point typically means both read and write access(marked as “0” in output), and inaccessibility (marked as “1” in output) often means it’s not writable.
		system_linux_nfs_mountpoint_availability	System Linux NFS Mountpoint Availability		Monitors the availability of NFS Mount points. The availability status of mount points is often determined by checking whether the NFS mount point is present in the current list of NFS shares compared to the list stored in the previous state. If a mount point was present in the previous state but is not in the current state, it is marked as “1” (not available). If it is present in both states, it is marked as “0” (available).

Agent G2 - Linux - Nginx Monitors

Description

Monitors Nginx application metrics

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - Nginx Monitors	nginx.connections.writing	Nginx Writing Connections	NULL	Nginx reads the request body, processes the request or writes response to a client.
	nginx.perconnections_requests	Nginx Requests per connection	Requests / conn	Average number of requests per connection.
	nginx.connections.reading	Nginx Reading Connections	NULL	Nginx reads the request header.
	nginx.connections.active	Nginx Connections	Active Connections	Number of all open connections including connections to backends.
	nginx.requests.handled	Nginx Handled Requests	requests	The number of requests served by connections handled by Nginx.
	nginx.requests_rate	Nginx Requests Rate	requests / sec	Average number of requests per second.
	nginx.connections_rate	Nginx Connections Rate	Connections / sec	Average number of connections per second.
	nginx.response.time	Nginx Response Time	Seconds	Time taken for Nginx request-response.
	nginx.connections.waiting	Nginx Waiting Connections	NULL	Keep-alive connections, actually it will be active - (reading + writing).

Agent G2 - Linux - NGINX Perfomance Check

Description

Monitors Nginx application metrics. This requires Nginx to be compiled with the Stub Status module.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - NGINX Perfomance Check	nginx.requests.handled	Nginx Handled Requests	NULL	The number of requests served by connections handled by Nginx.
	nginx.connections.reading	Nginx Reading Connections	NULL	Nginx reads the request header.
	nginx.response.time	Nginx Response Time	NULL	Time taken for Nginx request-response.
	nginx.requests_rate	Nginx Requests Rate	NULL	Average number of requests per second.
	nginx.connections.writing	Nginx Writing Connections	NULL	Nginx reads the request body, processes the request or writes response to a client.
	nginx.perconnections_requests	Nginx Requests per connection	NULL	Average number of requests per connection.
	nginx.connections.waiting	Nginx Waiting Connections	NULL	Keep-alive connections, actually it will be active - (reading + writing).
	nginx.connections_rate	Nginx Connections Rate	NULL	Average number of connections per second.
	nginx.connections.active	Nginx Connections	NULL	Number of all open connections including connections to backends.

Agent G2 - Linux - NTP Monitoring Offset

Description

Monitoring delay in seconds

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - NTP Monitoring Offset	ntp.offset	Ntp Offset	NULL	The time difference between the local clock and the NTP reference clock

Agent G2 - Linux NTP Statistics

Description

Monitors the NTP offset and jitter values of only system peer (the remote NTP server marked with a * at the beginning) for Linux systems.

Prerequisites

NTP needs to be installed and need Root privileges to execute the script.

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux NTP Statistics	system_linux_NTP_offset	System Linux NTP Offset	milliseconds	Monitors the time offset between the system clock and the Network Time Protocol (NTP) reference, indicating how much the system clock is ahead or behind the NTP reference.
Agent G2 - Linux NTP Statistics	system_linux_NTP_jitter	System Linux NTP Jitter	milliseconds	Monitors the jitter in the Network Time Protocol (NTP) synchronization, which reflects the variability in timekeeping accuracy. It measures the short-term fluctuations in the time offset between the system clock and the NTP reference.

Agent G2 - Linux - Nvidia GPU Monitoring

Description

Monitors Nvidia GPU Metrics like Gpu utilization, Power usage, Memory usage and Temperature per Gpu instance

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Nvidia Gpu Monitor	nvidia_dcgm_fb_mem_used	Nvidia Dcgm Framebuffer Memory Used	Percentage	Framebuffer Memory Used
	nvidia_dcgm_memory_temp	Nvidia Dcgm Memory Temp	Celsius	Memory temperature
	nvidia_dcgm_gpu_util	Nvidia Dcgm Gpu Util	Percentage	GPU utilization
	nvidia_dcgm_mem_copy_util	Nvidia Dcgm Mem Util	Percentage	Memory utilization
	nvidia_dcgm_gpu_temp	Nvidia Dcgm Gpu Temp	Celsius	GPU temperature
	nvidia_dcgm_power_usage	Nvidia Dcgm Power Usage	Watts	Power draw
	nvidia_dcgm_mem_clock	Nvidia Dcgm Mem Clock Freq	Megahertz	Memory clock frequency

Agent G2 - Linux - OKD ApiServer

Description

Template for monitoring OKD through Kubernetes API server

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - OKD ApiServer	apiserver.rest.client.requests.total.count	Kube apiserver Rest Client Requests Total Count	NULL	Number of HTTP requests, partitioned by status code, method, and host.
	apiserver.dropped.requests.total.count	Kube apiserver Dropped Requests Total Count	NULL	Monotonic count of requests dropped with Try-again-later response.
	apiserver.request.duration.seconds.bucket	Kube apiserver Request Duration Seconds Bucket	histogram	Response latency distribution in seconds for each verb, dry run value, group, version, resource, subresource, scope, and component.
	apiserver.request.count	Kube apiserver Request Count	NULL	Counter of apiserver requests broken out for each verb, group, version, resource, scope, component, client, and HTTP response contentType and code.
	apiserver.APIServiceRegistrationController.depth	Kube apiserver APIService Registration Controller Depth	NULL	Current depth of workqueue: APIServiceRegistrationController.
	apiserver.rest.client.requests.total	Kube apiserver Rest Client Requests Total	NULL	Number of HTTP requests, partitioned by status code, method, and host.
	apiserver.audit.event.total	Kube apiserver Audit Event Total	NULL	Counter of audit events generated and sent to the audit backend.
	apiserver.go.goroutines	Kube apiserver Goroutines	NULL	Number of goroutines that currently exist.
	apiserver.inflight.requests	Kube apiserver Inflight Requests	NULL	Maximal number of currently used inflight request limit of this apiserver per request kind in the last second.
	apiserver.go.threads.total	Kube apiserver Go Threads Total	NULL	Number of OS threads created.
	apiserver.authenticated.user.requests	Kube apiserver Authenticated User Requests	NULL	Counter of authenticated requests broken out by username.
	apiserver.etcd.object.counts	Kube apiserver ETCD Object Counts	NULL	Number of stored objects at the time of the last check split by kind.
	apiserver.http.requests.total.count	Kube apiserver HTTP Requests Total Count	NULL	Total number of HTTP requests made.
	apiserver.request.count.count	Kube apiserver Request Count Count	NULL	Counter of apiserver requests broken out for each verb, group, version, resource, scope, component, client, and HTTP response contentType and code.
	apiserver.authenticated.user.requests.count	Kube apiserver Authenticated User Requests Count	NULL	Counter of authenticated requests broken out by username.
	apiserver.http.requests.total	Kube apiserver HTTP Requests Total	NULL	Total number of HTTP requests made.

Agent G2 - Linux - OKD CoreDNS

Description

Kubernetes CoreDNS

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - OKD CoreDNS	coredns.request_duration.seconds.sum	Request Duration Seconds Sum	NULL	Duration to process each query.
	coredns.query.count	Query count	NULL	Total query count.
	coredns.response_size.bytes.sum	Response Size Bytes Sum	NULL	Size of the returned response in bytes.
	coredns.request_duration.seconds.count	Request Duration Seconds Count	NULL	Duration per upstream interaction.
	coredns.panics	Total Panics	NULL	Total number of panics.

Agent G2 - Linux - OKD Kube Controller

Description

Template for monitoring OKD using Kube Controller

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - OKD Kube Controller	controller.workqueue.work_unfinished_duration	Kube Controller Workqueue Unfinished Work Seconds	NULL	How many seconds of work has done that is in progress and hasn't been observed by work_duration. Large values indicate stuck threads.
	controller.go.goroutines	Kube Controller Go Goroutines	NULL	Number of goroutines that currently exist.
	controller.workqueue.adds	Kube Controller Workqueue Adds Total	NULL	Total number of adds handled by workqueue.
	controller.process.open_fds	Kube Controller Process Open Fds	NULL	Number of open file descriptors.
	controller.workqueue.retries	Kube Controller Workqueue Retries Total	NULL	Total number of retries handled by workqueue.
	controller.workqueue.nodes.count	Kube Controller Registered Nodes	NULL	Number of registered Nodes per zones.
	controller.workqueue.work_duration.sum	Kube Controller Workqueue Work Duration Seconds Sum	NULL	How long in seconds processing an item from workqueue takes.
	controller.workqueue.depth	Kube Controller Workqueue Depth	NULL	Current depth of workqueue.
	controller.workqueue.work_duration.count	Kube Controller Workqueue Work Duration Seconds Count	NULL	Total time in seconds processing an item from workqueue takes.
	controller.workqueue.nodes.evictions	Kube Controller Node Collector Evictions Number	NULL	Number of Node evictions that happened since the current instance of NodeController started.
	controller.threads	Kube Controller OS Threads	NULL	Number of OS threads created.
	controller.workqueue.work_longest_duration	Kube Controller Workqueue Longest Running Processor Seconds	NULL	How many seconds has the longest running processor for workqueue been running.
	controller.rate_limiter.use	Kube Controller Node Lifecycle Controller Rate Limiter Use	NULL	A metric measuring the saturation of the rate limiter for node_lifecycle_controller.
	controller.process.max_fds	Kube Controller Process Max Fds	NULL	Maximum number of open file descriptors.
	controller.workqueue.queue_duration.sum	Kube Controller Workqueue Queue Duration Seconds Sum	NULL	How long in seconds an item stays in workqueue before being requested.
	controller.workqueue.queue_duration.count	Kube Controller Workqueue Queue Duration Seconds Count	NULL	Total how long in seconds an item stays in workqueue before being requested.
	controller.workqueue.nodes.unhealthy	Kube Controller Node Collector Unhealthy Nodes in Zone	NULL	Number of not Ready Nodes per zones.

Agent G2 - Linux - Postfix Monitors

Description

Monitors postfix queues

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - Postfix Monitors	postfix.queues.deferred	Postfix Queues Deferred	NULL	Postfix deferred mails queues count
	postfix.queues.bounce	Postfix Queues Bounce	NULL	Postfix bounce mails queues count
	postfix.queues.maildrop	Postfix Queues Maildrop	NULL	Postfix maildrop mails queues count
	postfix.queues.incoming	Postfix Queues Incoming	NULL	Postfix incoming mail queues count
	postfix.queues.active	Postfix Queues Active	NULL	Postfix active mails queues count

Agent G2 - Linux - OKD Kube Scheduler

Description

Template for monitoring OKD using Kube Scheduler

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - OKD Kube Scheduler	scheduler.client.http.requests_duration.count	Kube Scheduler Rest Client Request Latency Seconds Count	NULL	Total request latency in seconds. Broken down by verb and URL.
	scheduler.binding.latency.count	Kube Scheduler Binding Latency Microseconds Count	NULL	Total Binding latency in microseconds count.
	scheduler.scheduling.scheduling_latency.count	Kube Scheduler Scheduling Latency Seconds Count	NULL	Scheduling latency in seconds split by sub-parts of the scheduling operation.
	scheduler.scheduling.scheduling_duration.quantile	Kube Scheduler Scheduling Duration Seconds	NULL	Scheduling latency in seconds split by sub-parts of the scheduling operation.
	scheduler.volume_scheduling_duration.sum	Kube Scheduler Volume Scheduling Duration Seconds Sum	NULL	Volume scheduling stage latency sum.
	scheduler.volume_scheduling_duration.count	Kube Scheduler Volume Scheduling Duration Seconds Count	NULL	Volume scheduling stage latency count.
	scheduler.go.goroutines	Kube Scheduler Go Goroutines	NULL	Number of goroutines that currently exist.
	scheduler.pod_preemption.victims	Kube Scheduler Pod Preemption Victims	NULL	Number of selected preemption victims.
	scheduler.scheduling.algorithm.preemption_duration.sum	Kube Scheduler Scheduling Algorithm Preemption Evaluation Sum	NULL	Scheduling algorithm preemption evaluation duration.
	scheduler.gc_duration_seconds.sum	Kube Scheduler Go GC Duration Seconds Sum	NULL	A summary of the GC invocation durations.
	scheduler.client.http.requests	Kube Scheduler Rest Client Requests Total	NULL	Number of HTTP requests, partitioned by status code, method, and host.
	scheduler.e2e.scheduling_latency.sum	Kube Scheduler E2E Scheduling Latency Microseconds Sum	NULL	E2e scheduling latency in microseconds (scheduling algorithm + binding).
	scheduler.scheduling.scheduling_duration.sum	Kube Scheduler Scheduling Duration Seconds Sum	NULL	Scheduling latency in seconds split by sub-parts of the scheduling operation.
	scheduler.e2e.scheduling_duration.sum	Kube Scheduler E2E Scheduling Duration Seconds Sum	NULL	E2e scheduling latency in seconds (scheduling algorithm + binding).
	scheduler.binding.latency.sum	Kube Scheduler Binding Latency Microseconds Sum	NULL	Binding latency in microseconds sum.
	scheduler.scheduling.scheduling_duration.count	Kube Scheduler Scheduling Duration Seconds Count	NULL	Scheduling latency in seconds split by sub-parts of the scheduling operation.
	scheduler.scheduling.scheduling_latency.quantile	Kube Scheduler Scheduling Latency Seconds	NULL	Scheduling latency in seconds split by sub-parts of the scheduling operation.
	scheduler.e2e.scheduling_duration.count	Kube Scheduler E2E Scheduling Duration Seconds Count	NULL	Total E2e scheduling latency in seconds (scheduling algorithm + binding).
	scheduler.binding.duration.count	Kube Scheduler Binding Duration Seconds Count	NULL	Total Binding duration in seconds count.
	scheduler.threads	Kube Scheduler OS Threads	NULL	Number of OS threads created.
	scheduler.binding.duration.seconds	Kube Scheduler Binding Duration Seconds Sum	NULL	Binding duration in seconds sum.
	scheduler.pod_preemption.attempts	Kube Scheduler Total Preemption Attempts	NULL	Total preemption attempts in the cluster till now.
	scheduler.process.open_fds	Kube Scheduler Process Open Fds	NULL	Number of open file descriptors.
	scheduler.scheduling.scheduling_latency.sum	Kube Scheduler Scheduling Latency Seconds Sum	NULL	Scheduling latency in seconds split by sub-parts of the scheduling operation.
	scheduler.client.http.requests_duration.sum	Kube Scheduler Rest Client Request Latency Seconds Sum	NULL	Request latency in seconds sum. Broken down by verb and URL.
	scheduler.schedule_attempts.total	Kube Scheduler Schedule Attempts Total	NULL	Number of attempts to schedule pods, by the result. 'unschedulable' means a pod could not be scheduled, while 'error' means an internal scheduler problem.
	scheduler.gc_duration_seconds.quantile	Kube Scheduler Go GC Duration Seconds	NULL	A summary of the GC invocation durations.
	scheduler.scheduling.algorithm.preemption_duration.count	Kube Scheduler Scheduling Algorithm Preemption Evaluation Count	NULL	Scheduling algorithm preemption evaluation duration.
	scheduler.scheduling.algorithm.predicate_duration.sum	Kube Scheduler Scheduling Algorithm Predicate Evaluation Sum	NULL	Scheduling algorithm predicate evaluation duration.
	scheduler.scheduling.algorithm_duration.sum	Kube Scheduler Scheduling Algorithm Duration Seconds Sum	NULL	Scheduling algorithm latency in seconds sum.
	scheduler.scheduling.algorithm.preemption_duration.count	Kube Scheduler Scheduling Algorithm Preemption Evaluation Count	NULL	Scheduling algorithm preemption evaluation duration.
	scheduler.e2e.scheduling_latency.count	Kube Scheduler E2E Scheduling Latency Microseconds Count	NULL	Total E2e scheduling latency in microseconds (scheduling algorithm + binding).
	scheduler.scheduling.algorithm.predicate_duration.count	Kube Scheduler Scheduling Algorithm Predicate Evaluation Count	NULL	Scheduling algorithm predicate evaluation duration.
	scheduler.scheduling.algorithm_duration.count	Kube Scheduler Scheduling Algorithm Duration Seconds Count	NULL	Total Scheduling algorithm latency in seconds count.
	scheduler.scheduling.algorithm.priority_duration.sum	Kube Scheduler Scheduling Algorithm Priority Evaluation Sum	NULL	Scheduling algorithm priority evaluation duration.
	scheduler.scheduling.algorithm_latency.sum	Kube Scheduler Scheduling Algorithm Latency Microseconds Sum	NULL	Scheduling algorithm latency in microseconds sum.
	scheduler.gc_duration_seconds.count	Kube Scheduler Go GC Duration Seconds Count	NULL	A summary of the GC invocation durations.
	scheduler.scheduling.algorithm_latency.count	Kube Scheduler Scheduling Algorithm Latency Microseconds Count	NULL	Total Scheduling algorithm latency in microseconds count.
	scheduler.cache.lookups	Kube Scheduler Equiv Cache Lookups Total	NULL	Total number of equivalence cache lookups, by whether or not a cache entry was found.
	scheduler.process.max_fds	Kube Scheduler Process Max Fds	NULL	Maximum number of open file descriptors.

Agent G2 - Linux - OKD Kube State

Description

Template for monitoring OKD using Kube State

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - OKD Kube State	kubernetes_state.node.cpu_allocatable	Node Cpu Allocatable	NULL	The CPU resources of a node that are available for scheduling.
	kubernetes_state.resourcequota.requests.storage.used	Resourcequota Requests Storage Used	NULL	Observed sum of storage bytes requested for a resource quota.
	kubernetes_state.resourcequota.persistentvolumeclaims.limit	Resourcequota Persistentvolumeclaims Limit	NULL	Hard limit of the number of PVC for a resource quota.
	kubernetes_state.node.cpu_capacity	Node Cpu Capacity	NULL	The total CPU resources of the node.
	kubernetes_state.replicaset.replicas_desired	Replicaset Replicas Desired	NULL	Number of desired pods for a ReplicaSet.
	kubernetes_state.resourcequota.pods.limit	Resourcequota Pods Limit	NULL	Hard limit of the number of pods for a resource quota.
	kubernetes_state.replicaset.replicas_ready	Replicaset Replicas Ready	NULL	The number of ready replicas per ReplicaSet.
	kubernetes_state.deployment.replicas_unavailable	Deployment Replicas Unavailable	NULL	The number of unavailable replicas per deployment.
	kubernetes_state.resourcequota.requests.memory.limit	Resourcequota Requests Memory Limit	NULL	Hard limit on the total of memory bytes requested for a resource quota.
	kubernetes_state.resourcequota.limits.cpu.limit	Resourcequota Limits Cpu Limit	NULL	Hard limit on the sum of CPU core limits for a resource quota.
	kubernetes_state.resourcequota.requests.memory.used	Resourcequota Requests Memory Used	NULL	Observed sum of memory bytes requested for a resource quota.
	kubernetes_state.replicaset.replicas	Replicaset Replicas	NULL	The number of replicas per ReplicaSet.
	kubernetes_state.resourcequota.limits.memory.limit	Resourcequota Limits Memory Limit	NULL	Hard limit on the sum of memory bytes limits for a resource quota.
	kubernetes_state.resourcequota.requests.cpu.used	Resourcequota Requests Cpu Used	NULL	Observed sum of CPU cores requested for a resource quota.
	kubernetes_state.resourcequota.services.nodeports.limit	Resourcequota Services Nodeports Limit	NULL	Hard limit of the number of node ports for a resource quota.
	kubernetes_state.daemonset.scheduled	Daemonset Scheduled	NULL	The number of nodes running at least one daemon pod and are supposed to.
	kubernetes_state.deployment.replicas_updated	Deployment Replicas Updated	NULL	The number of updated replicas per deployment.
	kubernetes_state.container.memory_requested	Container Memory Requested	NULL	The number of requested memory bytes by a container.
	kubernetes_state.container.cpu_limit	Container Cpu Limit	NULL	The limit on cpu cores to be used by a container.
	kubernetes_state.container.restarts	Container Restarts	NULL	The number of restarts per container.
	kubernetes_state.resourcequota.pods.used	Resourcequota Pods Used	NULL	Observed number of pods used for a resource quota.
	kubernetes_state.resourcequota.persistentvolumeclaims.used	Resourcequota Persistentvolumeclaims Used	NULL	Observed number of persistent volume claims used for a resource quota.
	kubernetes_state.resourcequota.limits.memory.used	Resourcequota Limits Memory Used	NULL	Observed sum of limits for memory bytes for a resource quota.
	kubernetes_state.deployment.replicas_available	Deployment Replicas Available	NULL	The number of available replicas per deployment.
	kubernetes_state.daemonset.misscheduled	Daemonset Misscheduled	NULL	The number of nodes running a daemon pod but are not supposed to.
	kubernetes_state.resourcequota.requests.cpu.limit	Resourcequota Requests Cpu Limit	NULL	Hard limit on the total of CPU core requested for a resource quota.
	kubernetes_state.resourcequota.limits.cpu.used	Resourcequota Limits Cpu Used	NULL	Observed sum of limits for CPU cores for a resource quota.
	kubernetes_state.resourcequota.services.loadbalancers.limit	Resourcequota Services Loadbalancers Limit	NULL	Hard limit of the number of loadbalancers for a resource quota.
	kubernetes_state.container.memory_limit	Container Memory Limit	NULL	The limit on memory to be used by a container.
	kubernetes_state.resourcequota.services.nodeports.used	Resourcequota Services Nodeports Used	NULL	Observed number of node ports used for a resource quota.
	kubernetes_state.resourcequota.services.limit	Resourcequota Services Limit	NULL	Hard limit of the number of services for a resource quota.
	kubernetes_state.node.pods_capacity	Node Pods Capacity	NULL	The total pod resources of the node.
	kubernetes_state.node.memory_allocatable	Node Memory Allocatable	NULL	The memory resources of a node that are available for scheduling.
	kubernetes_state.container.cpu_requested	Container Cpu Requested	NULL	The number of requested cpu cores by a container.
	kubernetes_state.deployment.rollingupdate.max_unavailable	Deployment Rollingupdate Max Unavailable	NULL	Maximum number of unavailable replicas during a rolling update of a deployment.
	kubernetes_state.daemonset.ready	Daemonset Ready	NULL	The number of nodes that should be running the daemon pod and have one or more of the daemon pod running and ready.
	kubernetes_state.deployment.replicas_desired	Deployment Replicas Desired	NULL	The number of desired replicas per deployment wrong help in kube-state-metrics.cross check
	kubernetes_state.resourcequota.services.used	Resourcequota Services Used	NULL	Observed number of services used for a resource quota.
	kubernetes_state.daemonset.desired	Daemonset Desired	NULL	The number of nodes that should be running the daemon pod.
	kubernetes_state.resourcequota.services.loadbalancers.used	Resourcequota Services Loadbalancers Used	NULL	Observed number of loadbalancers used for a resource quota.
	kubernetes_state.node.pods_allocatable	Node Pods Allocatable	NULL	The pod resources of a node that are available for scheduling.
	kubernetes_state.resourcequota.requests.storage.limit	Resourcequota Requests Storage Limit	NULL	Hard limit on the total of storage bytes requested for a resource quota.
	kubernetes_state.replicaset.fully_labeled_replicas	Replicaset Fully Labeled Replicas	NULL	The number of fully labeled replicas per ReplicaSet.
	kubernetes_state.node.memory_capacity	Node Memory Capacity	NULL	The total memory resources of the node.
	kubernetes_state.deployment.replicas	Deployment Replicas	NULL	The number of replicas per deployment.

Agent G2 - Linux - OS DISKIOPS Template

Description

Agent G2 - Linux - OS DISKIOPS Template

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - OS DISKIOPS Template	DISKIOPS	DISKIOPS	NULL	Monitors the Disk I/O Read in MBps, Disk Write MBps and Disk busy percentage.

Agent G2 - Linux Postfix Statistics

Description

Monitors the counts and sizes of specific mail queue types - namely, incoming, active, maildrop, deferred, and bounce queues.

Prerequisites:

Postfix needs to be installed and need Root privileges to execute the script.

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux Postfix Statistics	system_linux_postfix_active_mailqueue_size	System Linux Postfix Active Mailqueue Size	Bytes	Monitors the size (in bytes) of active emails in the Postfix mail queue.
	system_linux_postfix_deferred_mailqueue_size	System Linux Postfix Deferred Mailqueue Size	Bytes	**Monitors the size (in bytes) of deferred emails in the Postfix mail queue.
	system_linux_postfix_maildrop_mailqueue_size	System Linux Postfix Maildrop Mailqueue Size	Bytes	Monitors the size (in bytes) of emails in the Postfix mail queue marked for maildrop.
	system_linux_postfix_bounce_mailqueue_size	System Linux Postfix Bounce Mailqueue Size	Bytes	Monitors the size (in bytes) of bounced emails in the Postfix mail queue.
	system_linux_postfix_incoming_mailqueue_size	System Linux Postfix Incoming Mailqueue Size	Bytes	Monitors the size (in bytes) of incoming emails in the Postfix mail queue.
	system_linux_postfix_deferred_mailqueue_count	System Linux Postfix Deferred Mailqueue Count	Count	Monitors the count of deferred emails in the Postfix mail queue.
	system_linux_postfix_bounce_mailqueue_count	System Linux Postfix Bounce Mailqueue Count	Count	Monitors the count of bounced emails in the Postfix mail queue.
	system_linux_postfix_maildrop_mailqueue_count	System Linux Postfix Maildrop Mailqueue Count	Count	Monitors the count of emails in the Postfix mail queue marked for maildrop.
	system_linux_postfix_incoming_mailqueue_count	System Linux Postfix Incoming Mailqueue Count	Count	Monitors the count of incoming emails in the Postfix mail queue.
	system_linux_postfix_active_mailqueue_count	system_linux_postfix_active_mailqueue_count	Count	Monitors the count of active emails in the Postfix mail queue.

Agent G2 - Linux - PostgresDB Aliveness Check Status

Description

To monitor Postgresql db_aliveness, Supported versions of PostgreSQL 11 or later (Validated this template on version PostgreSQL-11 and 12 versions).

Prerequisites

Agent installed on the target machine.
Create a Postgres environment file and provide the file path as input parameter while applying the template.
We need to provide env path for single instance - <env path> & for multiple instances - <env path1>, <env path2>,<env path3> Along with setting up postgres environment this env file should contain other parameters like PGDATABASE,PGARCHIVEDIR,PGDATADIR,PGWALDIR,PGPORT,SERVICENAME.
Agent must have permission to access the provided .env file

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - PostgresDB Aliveness Check Status Monitor	postgres_check_dbalive	Postgres Check DBAlive	NULL	To monitor the aliveness of the postgres database

Agent G2 - Linux - PostgresDB Aliveness Check Status - v2

Description

To monitor the aliveness of the postgres database

Template Usage Guidelines:

Create a Postgres environment file and provide the file path as input parameter while applying the template.
We need to provide env path for single instance - <env path> & for multiple instances - <env path1>,<env path2>,<env path3>
Along with setting up postgres environment, this env file should contain other parameters like PGDATABASE,PGARCHIVEDIR,PGDATADIR,PGWALDIR,PGPORT,SERVICENAME.
Agent must have permission to access the provided .env file.
Sample pg_new_5432.env file data: export PATH=$PATH:/usr/pgsql-12/bin/ PGDATABASE=postgres PGPORT=5432 PGARCHIVEDIR=/var/lib/pgsql/backups_main/archive/ PGDATADIR=/var/lib/pgsql/12/data PGWALDIR=/var/lib/pgsql/12/data/pg_wal SERVICENAME=postgresql-12

Prerequisite

Agent must be installed on the target machine.

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - PostgresDB Aliveness Check Status Monitor - v2	postgres_check_dbalive	Postgres Check DBAlive		To monitor the aliveness of the postgres database

Agent G2 - Linux - PostgreSQL Monitors

Description

Agent G2 - Linux - PostgreSQL Monitors

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - PostgreSQL Monitors	postgres.dbstat.commit	PostgreSQL Commits	NULL	The total number of commits for this database since it was created or reset.
	postgres.dbstat.reads	PostgreSQL Reads	NULL	Reports information from the pg_stat_database view, The total number of disk blocks read.
	postgres.conn.idle	PostgreSQL Connections Idle	NULL	Checks number of connections idle in given state
	postgres.db.size	PostgreSQL Database Size	MB	Total Size of all dbs
	postgres.locks.not.granted	PostgreSQL Locks Not Granted	NULL	Checks the total number of locks are not granted on one or more databases
	postgres.conn.waiting	PostgreSQL Connections Waiting	NULL	Checks number of connections waiting in given state
	postgres.dbstat.tup.inserted	PostgreSQL Tup Inserted	NULL	Reports information from the pg_stat_database view, The total number of tuples inserted.
	postgres.autovac.freeze	PostgreSQL Autovac Freeze	%	Provides the percentage of current transactions to the max freeze number.
	postgres.backends	PostgreSQL Backends	%	Check the number of connections to the database. Compares it with the Max_connection provided in the postgres conf file
	postgres.dbstat.tup.returned	PostgreSQL Tup Returned	NULL	Reports information from the pg_stat_database view, The total number of tuples returned.
	postgres.dbstat.hits	PostgreSQL Hits	NULL	Reports information from the pg_stat_database view , The total number of buffer hits.
	postgres.tnxage.running	PostgreSQL Tnxage Running	NULL	Checks the number and duration of "running transaction" queries on one or more databases
	postgres.locks.granted	PostgreSQL Locks Granted	NULL	Checks the total number of locks are granted on one or more databases
	postgres.bloat	PostgreSQL Bloat	NULL	Checks the amount of bloat in tables and indexes
	postgres.dbstat.rollback	PostgreSQL Rollbacks	NULL	The total number of rollbacks for this database since it was created or reset.
	postgres.dbstat.tup.deleted	PostgreSQL Tup Deleted	NULL	Reports information from the pg_stat_database view, The total number of tuples deleted.
	postgres.conn.total	PostgreSQL Connections Total	NULL	Checks total number of connections in given state
	postgres.conn.running	PostgreSQL Connections Running	NULL	Checks number of connections running in given state
	postgres.ping	PostgreSQL Ping	NULL	Provides the Ping response time of PostgreSQL database.
	postgres.dbstat.tup.fetched	PostgreSQL Tup Fetched	NULL	Reports information from the pg_stat_database view, The total number of tuples fetched.
	postgres.conn.idle.tnx	PostgreSQL Connections Idle Tnx	NULL	Checks the number connections "idle in transaction" state
	postgres.locks.all	PostgreSQL Locks	NULL	Checks the total number of locks on one or more databases
	postgres.tnxage.idle.tnx	PostgreSQL Tnxage IdleTnx	NULL	Checks the number and duration of "idle in transaction" queries on one or more databases
	postgres.dbstat.tup.updated	PostgreSQL Tup Updated	NULL	Reports information from the pg_stat_database view, The total number of tuples updated.
	postgres.wal	PostgreSQL Wal	NULL	Checks how many WAL files exist in the pg_xlog directory

Agent G2 - Linux PostgresDB Aliveness Check Status - v3

Description:

Monitors the PostgreSQL database aliveness status. The metric value is 1 if the PostgreSQL database is alive; otherwise, the value is 0.

Prerequisites:

The Agent must be installed as Root on the target machine, with Agent version 14.0 or later.
Create a PostgreSQL environment file and provide the file path as an input parameter when applying the template.
For a single instance, provide the environment path as <env path>. For multiple instances, provide the environment paths as <env path1>, <env path2>, <env path3>.
This env file should contain other parameters such as PGDATADIR, PGPORT, SERVICENAME, SERVICELEVEL, POSTGRESUSER, and POSTGRESPATH. The last three parameters (SERVICELEVEL, POSTGRESUSER, POSTGRESPATH) are necessary only for checking the status of PostgreSQL using pg_ctl; otherwise, they are optional.
The agent must have execute permissions on the provided .env file.

The enhancements introduced in Version 3 (V3) of the script provide users with the flexibility to check the PostgreSQL aliveness status using either systemctl, pg_isready commands, or a combination of pg_isready and pg_ctl commands by giving respective parameters in env file as input.

Template Usage Guidelines: While assigning template on device, users need to pass specific input parameters -

For a single instance, provide the environment path as <env path>. For multiple instances, provide the environment paths as <env path1>, <env path2>, <env path3>.

Example:
Single Input Parameter:
/root/pg_new_5432.env

Multiple Input Parameters: /var/lib/pgsql/pg_new_5432.env,/var/lib/pgsql/pg_new_5433.env

Create a Postgres environment file and provide the file path as input parameter while applying the template.
We need to provide env path for single instance - <env path> & for multiple instances - <env path1>,<env path2>,<env path3>
Along with setting up postgres environment, this env file should contain other parameters like PGDATABASE,PGARCHIVEDIR,PGDATADIR,PGWALDIR,PGPORT,SERVICENAME.
Agent must have permission to access the provided .env file Example content of the .env file -

SampleContent while checking postgres status with pg_ctl command:

export PATH=$PATH:/usr/pgsql-12/bin/        
PGPORT=5432         
PGDATADIR=/var/lib/pgsql/12/data            
SERVICENAME=postgresql-12           
SERVICELEVEL=pgctl          
POSTGRESUSER=postgres           
POSTGRESPATH=/usr/pgsql-12/bin/

SampleContent while checking postgres status without pg_ctl:

export PATH=$PATH:/usr/pgsql-12/bin/        
PGPORT=5432         
PGDATADIR=/var/lib/pgsql/12/data            
SERVICENAME=postgresql-12

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux PostgresDB Aliveness Check Status Monitor - v3	postgres_check_dbalive	Postgres Check DBAlive	-	To monitor the aliveness of the postgres database

Agent G2 - Linux OS Performance Monitoring - Advanced

Description

Template to monitor Linux OS advanced performance metrics related to OS Resource parameters, Real memory (page outs & scan rate), Total and individual swap utilization. It has been validated on following Linux flavors: RHEL 7.9, Centos 7 ,Ubuntu 20.04, Open SUSE Linux.

Prerequisites

Applicable on devices which is running Opsramp Agent ( v7.0.0 or above)

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux OS Resource Parameters	system_linux_openFileDescriptors_UsedCount	System Linux OpenFileDescriptors Used Count	count	Current number of Open File Descriptors
	system_linux_messageQueueIDs_Utilization	System Linux MessageQueueIDs Utilization	%	Used percentage of current message queue ID's
	system_linux_Semaphores_Utilization	System Linux Semaphores Utilization	%	Semaphore arrays or sets used percentage
	system_linux_loggedInUsers_Pct	System Linux Logged In Users Pct	%	Current number of logged in users percentage
	system_linux_sharedMemoryIDs_Utilization	System Linux SharedMemoryIDs Utilization	%	Used percentage of shared memory ID's
	system_linux_messageQueueIDs_UsedCount	System Linux MessageQueueIDs Used Count	count	Current number of message queue ID’s in use
	system_linux_openFileDescriptors_Utilization	System Linux OpenFileDescriptors Utilization	%	Linux Open File Descriptors Used Percentage
	system_linux_runningProcesses_Pct	System Linux Running Processes Pct	%	Current running processes percentage
	system_linux_Semaphores_UsedCount	System Linux Semaphores Used Count	count	Current number of semaphore arrays in use
	system_linux_sharedMemoryIDs_UsedCount	System Linux SharedMemoryIDs Used Count	count	Current number of shared memory ID’s in use
	system_linux_loggedInUsers_Count	System Linux LoggedInUsers Count	count	Current number of logged in users
	system_linux_runningProcesses_Count	System Linux RunningProcesses Count	count	Current number of running processes
Agent G2 - Linux Real Memory Stats	system_linux_RealMemory_PageOuts_KiloBytesPerSec	System Linux Real Memory PageOuts KiloBytesPerSec	KBps	Memory pages page out rate in Kilo Bytes per second.
	system_linux_RealMemory_PageOuts_PagesPerSec	System Linux Real Memory PageOuts PagesPerSec	psec	Memory page out rate in pages per second.
	system_linux_RealMemory_Scan_Rate	System Linux Real Memory Scan Rate	psec	Number of pages scanned (directly) per second. It will collect data for last 10 min (i.e time configured in /etc/cron.d/sysstat file).\n\nPrerequisite: sysstat package should be installed and sar -B command should respond
Agent G2 - Linux Swap Memory Utilization	system_linux_swapMemory_Utilization	System Linux Swap Memory Utilization	%	Swap memory utilization in percent.
Agent G2 - Linux Swap Memory Utilization	system_linux_individual_SwapArea_Utilization	System Linux Individual Swap Area Utilization	%	Individual swap area utilization in percent.

Agent G2 - Linux OS Performance Monitoring - Advanced - V2

Description

Template to monitor Linux OS advanced performance metrics related to OS Resource parameters, Real memory (page ins, page outs, swap in, swap out & scan rate), Total and individual swap utilization. It has been validated on following Linux flavors: RHEL 7.9, Centos 7 ,Ubuntu 20.04, Open SUSE Linux.

Prerequisites

Applicable on devices which is running Opsramp Agent ( v7.0.0 or above)

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux OS Resource Parameters	system_linux_openFileDescriptors_UsedCount	System Linux OpenFileDescriptors Used Count	count	Current number of Open File Descriptors
	system_linux_messageQueueIDs_Utilization	System Linux MessageQueueIDs Utilization	%	Used percentage of current message queue ID's
	system_linux_Semaphores_Utilization	System Linux Semaphores Utilization	%	Semaphore arrays or sets used percentage
	system_linux_loggedInUsers_Pct	System Linux Logged In Users Pct	%	Current number of logged in users percentage
	system_linux_sharedMemoryIDs_Utilization	System Linux SharedMemoryIDs Utilization	%	Used percentage of shared memory ID's
	system_linux_messageQueueIDs_UsedCount	System Linux MessageQueueIDs Used Count	count	Current number of message queue ID’s in use
	system_linux_openFileDescriptors_Utilization	System Linux OpenFileDescriptors Utilization	%	Linux Open File Descriptors Used Percentage
	system_linux_runningProcesses_Pct	System Linux Running Processes Pct	%	Current running processes percentage
	system_linux_Semaphores_UsedCount	System Linux Semaphores Used Count	count	Current number of semaphore arrays in use
	system_linux_sharedMemoryIDs_UsedCount	System Linux SharedMemoryIDs Used Count	count	Current number of shared memory ID’s in use
	system_linux_loggedInUsers_Count	System Linux LoggedInUsers Count	count	Current number of logged in users
	system_linux_runningProcesses_Count	System Linux RunningProcesses Count	count	Current number of running processes
Agent G2 - Linux Real Memory Stats - V2	system_linux_RealMemory_PageOuts_KiloBytesPerSec	System Linux Real Memory PageOuts KiloBytesPerSec	KBps	Memory pages page out rate in Kilo Bytes per second.
	system_linux_RealMemory_PageOuts_PagesPerSec	System Linux Real Memory PageOuts PagesPerSec	psec	Memory page out rate in pages per second.
	system_linux_RealMemory_Scan_Rate	System Linux Real Memory Scan Rate	psec	Number of pages scanned (directly) per second. It will collect data for last 10 min (i.e time configured in /etc/cron.d/sysstat file).\n\nPrerequisite: sysstat package should be installed and sar -B command should respond
	system_linux_RealMemory_SwapOuts_KiloBytesPerSec	System Linux Real Memory SwapOuts KiloBytesPerSec	KBps	Swap out rate in Kilo Bytes per second.
	system_linux_RealMemory_PageIns_PagesPerSec	System Linux Real Memory PageIns PagesPerSec	psec	Memory pages page in rate in Pages per second.
	system_linux_RealMemory_PageIns_KiloBytesPerSec	System Linux Real Memory PageIns KiloBytesPerSec	KBps	Memory pages page in rate in Kilo Bytes per second.
	system_linux_RealMemory_SwapIns_KiloBytesPerSec	System Linux Real Memory SwapIns KiloBytesPerSec	KBps	Swap in rate in Kilo Bytes per second.
Agent G2 - Linux Swap Memory Utilization	system_linux_swapMemory_Utilization	System Linux Swap Memory Utilization	%	Swap memory utilization in percent.
Agent G2 - Linux Swap Memory Utilization	system_linux_individual_SwapArea_Utilization	System Linux Individual Swap Area Utilization	%	Individual swap area utilization in percent.

Agent G2 - Linux OS Performance Monitoring - Advanced - v3

Description:

Monitors the data related to OS resource parameters like Open FDs,Logge In users, Context Switches, Processes created, Running processes, Page Faults, Semaphores, Shared Memory IDs,Message queue IDs, TCP Connection states, Swap memory, Real memory Statistics and disk statistics. Ensure that the “ss” command is available in system to get TCP Connections data and util-linux package version 2.19 or higher, Kernel version above 2.6 be available on the system to get Disk Stats data.
Note: When the server is rebooted or when the disk counter’s valid range is exceeded, negative values for disk metrics will occur, as we are calculating rates.

Prerequisites

Ensure that the “ss” command is available in system to get TCP Connections data and util-linux package version 2.19 or higher, Kernel version above 2.6 be available on the system to get Disk Stats data.

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux Swap Memory Utilization	system_linux_swapMemory_Utilization	System Linux Swap Memory Utilization	%	Swap memory utilization in percent.
Agent G2 - Linux Swap Memory Utilization	system_linux_individual_SwapArea_Utilization	System Linux Individual Swap Area Utilization	%	Individual swap area utilization in percent.
Agent G2 - Linux Real Memory Stats - V2	system_linux_RealMemory_Scan_Rate	System Linux Real Memory Scan Rate	psec	Number of pages scanned (directly) per second. It will collect data for last 10 min (i.e time configured in /etc/cron.d/sysstat file). Prerequisite: sysstat package should be installed and sar -B command should respond
	system_linux_RealMemory_PageOuts_PagesPerSec	System Linux Real Memory PageOuts PagesPerSec	psec	Memory page out rate in pages per second.
	system_linux_RealMemory_PageOuts_KiloBytesPerSec	System Linux Real Memory PageOuts KiloBytesPerSec	KBps	Memory pages page out rate in Kilo Bytes per second.
	system_linux_RealMemory_PageIns_KiloBytesPerSec	System Linux Real Memory PageIns KiloBytesPerSec	KBps	Memory pages page in rate in Kilo Bytes per second.
	system_linux_RealMemory_PageIns_PagesPerSec	System Linux Real Memory PageIns PagesPerSec	psec	Memory pages page in rate in Pages per second.
	system_linux_RealMemory_SwapIns_KiloBytesPerSec	System Linux Real Memory SwapIns KiloBytesPerSec	KBps	Swap in rate in Kilo Bytes per second.
	system_linux_RealMemory_SwapOuts_KiloBytesPerSec	System Linux Real Memory SwapOuts KiloBytesPerSec	KBps	Swap out rate in Kilo Bytes per second.
Agent G2 - Linux TCP Connection States Monitor	system_linux_tcp_connection_states	System Linux TCP Connection States	count	Monitors the count of TCP connections in various states on the Linux system.
Agent G2 - Linux Disk Statistics	system_linux_disk_IOQueueLength	System Linux Disk IOQueueLength	null	Monitors the length of the I/O queue for disk operations.
	system_linux_disk_averageLatency	System Linux Disk AverageLatency	microsec	Monitors the average response time of the disk subsystem to process I/O requests.
	system_linux_disk_averageReadRequestSize	System Linux Disk AverageReadRequestSize	KB	Monitors the average size of read requests issued to the disk.
	system_linux_disk_averageRequestSize	System Linux Disk AverageRequestSize	KB	Monitors the average size of all read and write requests issued to the disk.
	system_linux_disk_averageWriteRequestSize	System Linux Disk AverageWriteRequestSize	KB	Monitors the average size of write requests issued to the disk.
	system_linux_disk_timeUtilization	System Linux Disk TimeUtilization	%	Monitors the utilization of the disk, measured as the percentage of time the disk is actively processing I/O operations.
	system_linux_disk_readOperationsRate	System Linux Disk ReadOperationsRate	Monitors the rate of read operations issued to the disk per second.	psec
	system_linux_disk_readThroughput	System Linux Disk ReadThroughput	KBps	Monitors the rate of data read from the disk per second.
	system_linux_disk_averageReadWaitTime	System Linux Disk AverageReadWaitTime	microsec	Monitors the average wait time for read requests.
	system_linux_disk_averageRequestWaitTime	System Linux Disk AverageRequestWaitTime	microsec	Monitors the time a disk operation (read and write) waits in the I/O queue before being processed.
	system_linux_disk_writeOperationsRate	System Linux Disk WriteOperationsRate	psec	Monitors the rate of write operations issued to the disk per second.
	system_linux_disk_writeThroughput	System Linux Disk WriteThroughput	KBps	Monitors the rate of data written to the disk per second.
	system_linux_disk_averageWriteWaitTime	System Linux Disk AverageWriteWaitTime	microsec	Monitors the average wait time for write requests.
Agent G2 - Linux OS Resource Parameters - v2	system_linux_openFileDescriptors_Utilization	System Linux OpenFileDescriptors Utilization	%	Linux Open File Descriptors Used Percentage
	system_linux_openFileDescriptors_UsedCount	System Linux OpenFileDescriptors Used Count	count	Current number of Open File Descriptors
	system_linux_loggedInUsers_Pct	System Linux Logged In Users Pct	%	Current number of logged in users percentage
	system_linux_loggedInUsers_Count	System Linux LoggedInUsers Count	count	Current number of logged in users
	system_linux_runningProcesses_Pct	System Linux Running Processes Pct	%	Current running processes percentage
	system_linux_runningProcesses_Count	System Linux RunningProcesses Count	count	Current number of running processes
	system_linux_Semaphores_Utilization	System Linux Semaphores Utilization	%	Semaphore arrays or sets used percentage
	system_linux_Semaphores_UsedCount	System Linux Semaphores Used Count	count	Current number of semaphore arrays in use
	system_linux_messageQueueIDs_Utilization	System Linux MessageQueueIDs Utilization	%	Used percentage of current message queue ID's
	system_linux_messageQueueIDs_UsedCount	System Linux MessageQueueIDs Used Count	count	Current number of message queue ID?s in use
	system_linux_sharedMemoryIDs_Utilization	System Linux SharedMemoryIDs Utilization	%	Used percentage of shared memory ID's
	system_linux_sharedMemoryIDs_UsedCount	System Linux SharedMemoryIDs Used Count	count	Current number of shared memory ID?s in use
	system_linux_createdProcessesPerSec	System Linux CreatedProcesses PerSec	Count per sec	Provides the count of processes created or managed per second on the Linux system since the system was rebooted.
	system_linux_pageFaultsPerSec	System Linux PageFaults PerSec	Count per sec	Monitors the count of page faults per second on the Linux system.
	system_linux_kernelContextSwitchesPerSec	System Linux KernelContextSwitches PerSec	Count per sec	Monitors the count of context switches per second on the Linux system.

Agent G2 - Linux Process Statistics Monitoring

Description

Monitors the process statistics of given process list. Should give process list in configuration parameter - custom arguments param

Prerequisites

NULL

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux Process Statistics Monitor	system.process.stats.cpu	System Process Stats Cpu Usage	%	Monitors Cpu Usage of each process of Linux Device.
	system.process.stats.count	System Process Stats Instance Count	count	Monitors Instance count of each process of Linux Device.
	system.process.stats.threads	System Process Stats Thread Count	count	Monitors thread count of each process of Linux Device.
	system.process.stats.open.fds	System Process Stats Open Fd count	count	Monitors open fd count of each process of Linux Device.
	system.process.stats.memory	System Process Stats Memory Usage	%	Monitors Memory Usage of each process of Linux Device.

Agent G2 - Linux Process Statistics Monitoring - v2

Description

Agent G2 - Linux Process Statistics Monitoring - v2

Prerequisites

NULL

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux Process Statistics Monitor -v2	system.process.stats.cpu	System Process Stats Cpu Usage	%	Monitors Cpu Usage of each process of Linux Device.
	system.process.stats.count	System Process Stats Instance Count	count	Monitors Instance count of each process of Linux Device.
	system.process.stats.threads	System Process Stats Thread Count	count	Monitors thread count of each process of Linux Device.
	system.process.stats.open.fds	System Process Stats Open Fd count	count	Monitors open fd count of each process of Linux Device.
	system.process.stats.memory	System Process Stats Memory Usage	%	Monitors Memory Usage of each process of Linux Device.

Agent G2 - Linux Veritas Cluster Monitoring

Description

Template to monitor veritas Linux cluster parameters like cluster node state, service group state, resource state, service group failover status and this template need to assigned on all cluster nodes. This template tested with two node veritas Linux cluster (version - “Veritas_InfoScale_7.3.1”) running on CentOS7.

Prerequisites

NULL

Monitor Name	Metric Name	Metric Display Name	Unit	Description
G2 - Linux Veritas Cluster Monitor	system_linux_veritas_cluster_resource_state	System Linux Veritas Cluster Resource State		System Linux Veritas Cluster Resource State - Below are the possible states of the resource: OFFLINE:0 ONLINE:1 FAULTED:2 PARTIAL:3 STARTING:4 STOPPING:5 MIGRATING:6 OFFLINE\|FAULTED:7 OFFLINE\|STARTING:8 PARTIAL\|FAULTED:9 PARTIAL\|STARTING:10 PARTIAL\|STOPPING:11 ONLINE\|STOPPING:12
	system_linux_veritas_cluster_group_online_status	System Linux Veritas Cluster Group Online Status		System Linux Veritas Cluster Group Online Status - Below are the possible values : 0 - Service group online on cluster node. 1 - Service group not online on any cluster node.
	system_linux_veritas_cluster_resource_online_status	System Linux Veritas Cluster Resource Online Status		System Linux Veritas Cluster Resource Online Status . Below are the possible values: 0 - Resource state in online on any cluster node, 1 - Resource state is not online on any cluster node
	system_linux_veritas_cluster_node_state	System Linux Veritas Cluster Node State		System Linux Veritas Cluster Node State - Below are the possible states: RUNNING : 0 ADMIN_WAIT : 1 CURRENT_DISCOVER_WAIT : 2 CURRENT_PEER_WAIT : 3 EXITING : 4 EXITED : 5 EXITING_FORCIBLY : 6 FAULTED : 7 INITING : 8 LEAVING : 9 LOCAL_BUILD : 10 REMOTE_BUILD : 11 STALE_ADMIN_WAIT : 12 STALE_DISCOVER_WAIT : 13 STALE_PEER_WAIT : 14 UNKNOWN : 15
	system_linux_veritas_cluster_group_state	System Linux Veritas Cluster Group State		System Linux Veritas Cluster Group State - Below are the possible values : OFFLINE\t: 0 ONLINE\t: 1 FAULTED : 2 PARTIAL : 3 STARTING : 4 STOPPING : 5 MIGRATING : 6 OFFLINE\|FAULTED : 7 OFFLINE\|STARTING : 8 PARTIAL\|FAULTED : 9 PARTIAL\|STARTING : 10 PARTIAL\|STOPPING : 11 ONLINE\|STOPPING : 12
	G2 - Linux Veritas Cluster Group Failover Monitor	system_linux_veritas_cluster_group_failover_status	System Linux Veritas Cluster Group Failover Status		System Linux Veritas Cluster Group Failover Status - Below are the possible values: 0 - No change. 1 - Cluster group change from one node to another due to failover. 2 - The specific cluster group is not online on any cluster node.

Agent G2 - Linux - RabbitMQ Monitors

Description

Monitors RabbitMQ monitor metrics using the rabbitmq-management plugin which provides a HTTP-based API.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - RabbitMQ Monitors	rabbitmq.node.disk.free	RabbitMQ Free Disk	MB	The free disk of the rabbitmq node in MB.
	rabbitmq.queue.consumers.active	RabbitMQ Active Consumers	NULL	Number of active consumers. An active consumer is one which could immediately receive any messages sent to the queue.
	rabbitmq.node.mem.used	RabbitMQ Node Memory Utilization	MB	The memory used by the rabbitmq node in MB.
	rabbitmq.node.fd.used	RabbitMQ OpenFDs	NULL	Number of open file descriptors used.
	rabbitmq.queue.consumers	RabbitMQ Consumers	NULL	Number of consumers.
	rabbitmq.queue.memory	RabbitMQ Memory	MB	Memory consumed by the Erlang process associated with the queue, including stack, heap, and internal structures.
	rabbitmq.node.uptime	RabbitMQ Uptime	NULL	Uptime of the RabbitMQ server.
	rabbitmq.queue.messages	RabbitMQ Messages	NULL	Sum of ready and unacknowledged messages (queue depth).
	rabbitmq.node.sockets.used	RabbitMQ Sockets Used	NULL	Number of sockets used.
	rabbitmq.queue.messages.unacknowledged	RabbitMQ Messages Unacknowledged	NULL	Number of messages delivered to clients but not yet acknowledged.
	rabbitmq.objects.overview	RabbitMQ Overview Objects	NULL	Overview of all objects.
	rabbitmq.queue.messages.ready	RabbitMQ Messages Ready	NULL	Number of messages ready to be delivered to clients.
	rabbitmq.node.proc.used	RabbitMQ Erlang Processes Used	NULL	Number of Erlang processes used.

Agent G2 - Linux - RedisDB Monitors

Description

Monitors RedisDB application metrics

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - RedisDB Monitors	redis.clients.biggest.inputbuf	Redis Clients Biggest InputBuf	NULL	Biggest input buffer among current client connections.
	redis.mem.fragmentation_ratio	Redis-Mem.fragmentation_ratio	NULL	Ratio between rss memory used and total memory used.
	redis.mem.peak	Redis Peak Memory	MB	Peak memory consumed by Redis (in Mbytes).
	redis.aof.last.rewritetime	Redis AOF Last Rewrite Op Time	NULL	Duration of the last AOF rewrite operation in seconds.
	redis.replica.sync_left_bytes	Redis-Replica.sync_left_bytes	NULL	Number of bytes left before SYNCing is complete
	redis.rdb.last_bgsave_time	Redis-Rdb.last_bgsave_time	NULL	Duration of the last RDB save operation in seconds.
	redis.key.hits_rate	Redis Key Hit Rate	NULL	The rate of successful lookup of keys in the main dictionary.
	redis.clients.longest.outputlist	Redis Clients Longest OutputList	NULL	Longest output list among current client connections.
	redis.rdb.last.bgsavetime	Redis RDB Last Save Op Time	NULL	Duration of the last RDB save operation in seconds.
	redis.net.rejected	Redis Connections Rejected	NULL	Number of connections rejected because of maxclients limit.
	redis.clients.biggest_input_buf	Redis-Clients.biggest_input_buf	NULL	Biggest input buffer among current client connections.
	redis.uptime	Redis Uptime	NULL	Checks the uptime of the Redis service.
	redis.aof.size	Redis AOF Size	MB	AOF current file size in MB.
	redis.pubsub.patterns	Redis Pubsub Patterns	NULL	Global number of pub/sub pattern with client subscriptions.
	redis.stats.keyspace_hits	Redis Keyspace Hits	NULL	Number of successful lookup of keys in the main dictionary per second.
	redis.clients.longest_output_list	Redis-Clients.longest_output_list	NULL	Longest output list among current client connections.
	redis.key.misses_rate	Redis Key Miss Rate	NULL	The rate of failed lookup of keys in the main dictionary.
	redis.net.commands	Redis Commands	NULL	The number of commands processed by the server
	redis.replica.syncleftbytes	Redis Replication Bytes Lag	NULL	Number of bytes left before SYNCing is complete
	redis.keyspace.misses	Redis Keyspace Misses	NULL	Number of failed lookup of keys in the main dictionary per second.
	redis.keys.evicted	Redis Evicted Keys	NULL	Number of evicted keys due to maxmemory limit.
	redis.perf.latest_fork_usec	Redis Latest Fork Op Time	NULL	Duration of the latest fork operation in microseconds.
	redis.net.clients	Redis Client Connections	NULL	Number of client connections (excluding connections from slaves).
	redis.changes	Redis Changes	NULL	Number of changes since the last save.
	redis.keys.total	Redis Total Keys	NULL	Provides the total number of keys from all the DBs.
	redis.mem.rss	Redis RSS Memory	MB	Number of bytes that Redis allocated as seen by the operating system (a.k.a resident set size). This is the number reported by tools such as top and ps.
	redis.rdb.changes	Redis RDB Changes	NULL	Number of changes since the last dump.
	redis.pubsub.channels	Redis Pubsub Channels	NULL	Global number of pub/sub channels with client subscriptions.
	redis.replica.last_io_seconds_ago	Redis-Replica.last_io_seconds_ago	NULL	Number of seconds since the last interaction with master.
	redis.clients.blocked	Redis Clients Blocked	NULL	Number of clients pending on a blocking call.
	redis.mem.lua	Redis LUA Memory	MB	Number of Mbytes used by the Lua engine.
	redis.mem.used	Redis Used Memory	MB	Total number of Mbytes allocated by Redis using its allocator (either standard libc, jemalloc, or an alternative allocator such as tcmalloc).
	redis.replica.last.io.Secondsago	Redis Replication Lag	NULL	Number of seconds since the last interaction with master.
	redis.connections	Redis Connections	NULL	The number of connections accepted by the server per second.
	redis.mem.fragmentation.ratio	Redis Memory Fragmentation Ratio	NULL	Ratio between rss memory used and total memory used.
	redis.keys.expired	Redis Expired Keys	NULL	Total number of key expiration events.
	redis.aof.last_rewrite_time	Redis-Aof.last_rewrite_time	NULL	Duration of the last AOF rewrite operation in seconds.
	redis.net.slaves	Redis Connected Slaves	NULL	Number of connected slaves.

Agent G2 - Linux - Riak DB Monitors

Description

Agent G2 - Linux - Riak DB Monitors

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - Riak DB Monitors	riak.node_get_fsm_objsize_mean	Riak Get Fsm Mean Object Size	NULL	Mean object size encountered by this node within the last minute
	riak.redir_requests	Riak Redirected Requests	NULL	Average number of requests this node has redirected to other nodes for coordination per second
	riak.pipe_vnodes.running.count	Riak Running Pipe Vnodes	NULL	Number of pipe virtual node queues running in the last minute
	riak.vnode_index_writes	Riak Vnode Index Writes	NULL	Average number of vnode index write operations performed per second
	riak.node_get_fsm_objsize_95	Riak Get Fsm 95 Object Size	NULL	95th percentile object size encountered by this node within the last minute
	riak.node_get_fsm_siblings_100	Riak Get Fsm 100 Siblings	NULL	100th percentile of siblings encountered during all GET operations by this node within the last minute
	riak.node_gets	Riak Node GETs	NULL	Average number of GETs coordinated by this node per second, including GETs to non-local vnodes
	riak.node_get_fsm_objsize_100	Riak Get Fsm 100 Object Size	NULL	100th percentile object size encountered by this node within the last minute
	riak.vnode_index_reads	Riak Vnode Index Reads	NULL	Average number of vnode index read operations performed per second
	riak.ring_num_partitions	Riak Ring Partitions	NULL	Number of partitions in the ring
	riak.pipeline.active	Riak Active Pipelines	NULL	The number of pipelines active in the last 60 seconds
	riak.vnode.puts	Riak Vnode PUTs	NULL	Average number of PUTS coordinated by local vnodes per second
	riak.node_get_fsm_objsize_median	Riak Get Fsm Median Object Size	NULL	Median object size encountered by this node within the last minute
	riak.node_put_fsm_time_95	Riak Put Fsm 95 Time	NULL	95th percentile time between reception of client PUT request and subsequent response to client
	riak.sys.process_count	Riak Process Count	NULL	Number of Erlang processes
	riak.node_get_fsm_time_100	Riak Get Fsm 100 Time	NULL	100th percentile time between reception of client GET request and subsequent response to client
	riak.node_get_fsm_time_mean	Riak Get Fsm Mean Time	NULL	Mean time between reception of client GET request and subsequent response to client
	riak.node_get_fsm_siblings_mean	Riak Get Fsm Mean Siblings	NULL	Mean number of siblings encountered during all GET operations by this node within the last minute
	riak.vnode.gets	Riak Vnode GETs	NULL	Average number of GETs coordinated by local vnodes per second
	riak.node_get_fsm_siblings_median	Riak Get Fsm Median Siblings	NULL	Median number of siblings encountered during all GET operations by this node within the last minute
	riak.node_get_fsm_siblings_95	Riak Get Fsm 95 Siblings	NULL	95th percentile of siblings encountered during all GET operations by this node within the last minute
	riak.precommit.fails	Riak Pre-commit Failures	NULL	Number of pre commit hook failures
	riak.node_get_fsm_time_median	Riak Get Fsm Median Time	NULL	Median time between reception of client GET request and subsequent response to client
	riak.pipeline.errors	Riak Pipeline Errors	NULL	The average number of pipeline creation errors per second
	riak.kv_vnodes.running.count	Riak Running KV Vnodes	NULL	Number of key/value virtual node queues running in the last minute
	riak.postcommit.fails	Riak Post-commit Failures	NULL	Number of post commit hook failures
	riak.pbc_active	Riak Active PB Connections	NULL	Number of currently active protocol buffer connections
	riak.node_put_fsm_time_median	Riak Put Fsm Median Time	NULL	Median time between reception of client PUT request and subsequent response to client
	riak.vnode_index_deletes	Riak Vnode Index Deletes	NULL	Average number of vnode index delete operations performed per second
	riak.node_put_fsm_time_mean	Riak Put Fsm Mean Time	NULL	Mean time between reception of client PUT request and subsequent response to client
	riak.node_put_fsm_time_100	Riak Put Fsm 100 Time	NULL	100th percentile time between reception of client PUT request and subsequent response to client
	riak.node.puts	Riak Node PUTs	NULL	Average number of PUTs coordinated by this node per second, including PUTs to non-local vnodes
	riak.pipeline.creates	Riak Pipeline Creations	NULL	The average number of pipelines created per second
	riak.node_get_fsm_time_95	Riak Get Fsm 95 Time	NULL	95th percentile time between reception of client GET request and subsequent response to client
	riak.pbc_connects	Riak New PB Connections	NULL	Number of new protocol buffer connections established during the last minute
	riak.memory.processes_used	Riak Memory Used	NULL	Total amount of memory used by Erlang processes
	riak.read_repairs	Riak Read Repairs	NULL	Average number of read repair operations this node has coordinated per second

Agent G2 - Linux - RiakDB Monitors

Description

It monitors DB parameters like Post-commit Failures, Pre-commit Failures, Node GETs, Vnode GETs, Memory Used, Get Fsm 100 Object Size, Get Fsm 100 Siblings, Get Fsm 100 Time, Get Fsm 95 Object Size, Get Fsm 95 Siblings, Get Fsm 95 Time, Get Fsm Mean Object Size, Get Fsm Mean Siblings, Get Fsm Mean Time, Get Fsm Median Object Size, Get Fsm Median Siblings, Get Fsm Median Time, Put Fsm 100 Time, Put Fsm 95 Time, Put Fsm Mean Time, Put Fsm Median Time, Active PB Connections, New PB Connections, Active Pipelines, Pipeline Creations, Pipeline Errors, Node PUTs, Vnode PUTs, Read Repairs, Redirected Requests, Ring Partitions, Running KV Vnodes, Running Pipe Vnodes, Process Count, Vnode Index Deletes, Vnode Index Reads, Vnode Index Writes

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - RiakDB Monitors	riak.postcommit.fails	Riak Post-commit Failures	NULL	Number of post commit hook failures
	riak.pbc_active	Riak Active PB Connections	NULL	Number of currently active protocol buffer connections
	riak.vnode_index_deletes	Riak Vnode Index Deletes	NULL	Average number of vnode index delete operations performed per second
	riak.node_get_fsm_time_mean	Riak Get Fsm Mean Time	NULL	Mean time between reception of client GET request and subsequent response to client
	riak.node_get_fsm_objsize_median	Riak Get Fsm Median Object Size	NULL	Median object size encountered by this node within the last minute
	riak.vnode_index_reads	Riak Vnode Index Reads	NULL	Average number of vnode index read operations performed per second
	riak.node_get_fsm_time_95	Riak Get Fsm 95 Time	NULL	95th percentile time between reception of client GET request and subsequent response to client
	riak.node_put_fsm_time_95	Riak Put Fsm 95 Time	NULL	95th percentile time between reception of client PUT request and subsequent response to client
	riak.pipeline.active	Riak Active Pipelines	NULL	The number of pipelines active in the last 60 seconds
	riak.pipe_vnodes.running.count	Riak Running Pipe Vnodes	NULL	Number of pipe virtual node queues running in the last minute
	riak.ring_num_partitions	Riak Ring Partitions	NULL	Number of partitions in the ring
	riak.memory.processes_used	Riak Memory Used	NULL	Total amount of memory used by Erlang processes
	riak.node_get_fsm_siblings_100	Riak Get Fsm 100 Siblings	NULL	100th percentile of siblings encountered during all GET operations by this node within the last minute
	riak.node_get_fsm_objsize_mean	Riak Get Fsm Mean Object Size	NULL	Mean object size encountered by this node within the last minute
	riak.node_get_fsm_time_median	Riak Get Fsm Median Time	NULL	Median time between reception of client GET request and subsequent response to client
	riak.pbc_connects	Riak New PB Connections	NULL	Number of new protocol buffer connections established during the last minute
	riak.vnode.puts	Riak Vnode PUTs	NULL	Average number of PUTS coordinated by local vnodes per second
	riak.node_put_fsm_time_mean	Riak Put Fsm Mean Time	NULL	Mean time between reception of client PUT request and subsequent response to client
	riak.redir_requests	Riak Redirected Requests	NULL	Average number of requests this node has redirected to other nodes for coordination per second
	riak.node_put_fsm_time_median	Riak Put Fsm Median Time	NULL	Median time between reception of client PUT request and subsequent response to client
	riak.node.gets	Riak Node GETs	NULL	Average number of GETs coordinated by this node per second, including GETs to non-local vnodes
	riak.node_get_fsm_objsize_95	Riak Get Fsm 95 Object Size	NULL	95th percentile object size encountered by this node within the last minute
	riak.kv_vnodes.running.count	Riak Running KV Vnodes	NULL	Number of key/value virtual node queues running in the last minute
	riak.node_get_fsm_siblings_median	Riak Get Fsm Median Siblings	NULL	Median number of siblings encountered during all GET operations by this node within the last minute
	riak.read_repairs	Riak Read Repairs	NULL	Average number of read repair operations this node has coordinated per second
	riak.node_put_fsm_time_100	Riak Put Fsm 100 Time	NULL	100th percentile time between reception of client PUT request and subsequent response to client
	riak.sys.process_count	Riak Process Count	NULL	Number of Erlang processes
	riak.vnode.gets	Riak Vnode GETs	NULL	Average number of GETs coordinated by local vnodes per second
	riak.node_get_fsm_siblings_mean	Riak Get Fsm Mean Siblings	NULL	Mean number of siblings encountered during all GET operations by this node within the last minute
	riak.pipeline.errors	Riak Pipeline Errors	NULL	The average number of pipeline creation errors per second
	riak.precommit.fails	Riak Pre-commit Failures	NULL	Number of pre commit hook failures
	riak.pipeline.creates	Riak Pipeline Creations	NULL	The average number of pipelines created per second
	riak.node.puts	Riak Node PUTs	NULL	Average number of PUTs coordinated by this node per second, including PUTs to non-local vnodes
	riak.vnode_index_writes	Riak Vnode Index Writes	NULL	Average number of vnode index write operations performed per second
	riak.node_get_fsm_siblings_95	Riak Get Fsm 95 Siblings	NULL	95th percentile of siblings encountered during all GET operations by this node within the last minute
	riak.node_get_fsm_objsize_100	Riak Get Fsm 100 Object Size	NULL	100th percentile object size encountered by this node within the last minute
	riak.node_get_fsm_time_100	Riak Get Fsm 100 Time	NULL	100th percentile time between reception of client GET request and subsequent response to client

Agent G2 - Linux Services Monitoring

Description

Monitors the status of the overall state the service is in. It can be active, reloading, inactive, failed, activating, or deactivating.

Template Usage Guidelines:

While applying this template on the device, users need to provide specific input parameters in below two formats only.

Format 1: all (case-insensitive) If “all” is specified as custom script arguments, the script monitors all available services along with alert tokens, that provide additional information, including the total count of services and the count of services in each available state.
Format 2: tuned,opsramp.*, systemd (provide service names without .service extension as shown here) Users can specify comma-separated service names or service regex patterns for a more focused monitoring approach. The script filters and retrieves status information about the mentioned services only.

Note: We strongly recommend specifying only particular service names in input parameters,(that is Format 2) as monitoring all services may significantly increase the system load, especially in environments with a large number of services.

Prerequisites

This template only works on systems having Systemd as the default init system.

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux Services Monitor	system_linux_services_status	System Linux Services Status	-	Monitors the status of the overall state the service is in. It can be active, reloading, inactive, failed, activating, or deactivating.

Agent G2 - Linux - Squid Monitors

Description

Monitoring template for squid proxy application

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - Squid Monitors	squid.server.errors	Squid Server Errors	NULL	Rate of server requests that resulted in error
	squid.fqdn.cache.entries	Squid FQDN Cache Entries	NULL	Number of FQDN cache entries
	squid.icp.packets.received	Squid ICP Packets Received	NULL	Rate of ICP packets received
	squid.icp.traffic.in	Squid ICP Traffic In	NULL	Amount of ICP data received
	squid.server.traffic.in	Squid Server Traffic In	NULL	Rate of traffic read by server for all protocols
	squid.icp.packets.sent	Squid ICP Packets Sent	NULL	Rate of ICP packets sent
	squid.request.failure.ratio	Squid Request Failure Ratio	%	The average ratio between the number of failed and successful requests
	squid.service.times	Squid Service Times	NULL	The median of various service time (or response time) distributions
	squid.server.traffic.out	Squid Server Traffic Out	NULL	Rate of traffic written to origin servers for all protocols
	squid.page.faults	Squid Page Faults	NULL	Page faults with physical i/o
	squid.icp.replies.queued	Squid ICP Replies Queued	NULL	This counter shows how many times an ICP message was queued for re-transmission
	squid.server.requests	Squid Server Requests	NULL	Rate of server-side requests to HTTP servers
	squid.unlink.requests	Squid Unlink Requests	NULL	Rate of unlink requests
	squid.client.http.requests	Squid Client Http Requests	NULL	The rate of the number of HTTP requests.
	squid.client.http.traffic.out	Squid Client Http Traffic Out	NULL	Rate of response data traffic sent to clients
	squid.aborted.requests	Squid Aborted Requests	NULL	Rate of aborted requests
	squid.requests.disk.hit.ratio	Squid Requests Disk Hit Ratio	%	These values represent the percentage of plain cache hits served from disk
	squid.cache.hit.ratio	Squid Cache Hit Ratio	%	The percentage of HTTP requests that result in a cache hit.
	squid.clients	Squid Clients	NULL	Number of clients accessing cache, client actually means IP address. Squid assumes that each client has a unique IP address
	squid.client.http.errors	Squid Client Http Errors	NULL	The rate of the number of HTTP errors.
	squid.client.http.traffic.in	Squid Client Http Traffic In	NULL	Rate of request data traffic received from clients
	squid.fqdn.cache.statistics	Squid FQDN Cache Statistics	NULL	The FQDN cache is similar to the IP cache, except that it stores address-to-hostname lookups
	squid.ip.cache.entries	Squid IP Cache Entries	NULL	Number of IP cache entries
	squid.icp.messages.sent	Squid ICP Messages Sent	NULL	The total number of ICP messages sent since Squid was started.
	squid.icp.messages.received	Squid ICP Messages Received	NULL	The total number of ICP messages received since Squid was started.
	squid.cache.byte.hit.ratio	Squid Cache Byte Hit Ratio	%	Squid calculates byte hit ratio by comparing the number of bytes received from origin servers (or neighbors) to the number of bytes sent to clients
	squid.select.loops	Squid Select Loops	NULL	Rate of select loops called
	squid.ip.cache.statistics	Squid IP Cache Statistics	NULL	The IP cache contains cached results of hostname-to-address lookups.
	squid.request.memory.hit.ratio	Squid Request Memory Hit Ratio	%	These values represent the percentage of all cache hits that were served from memory
	squid.icp.traffic.out	Squid ICP Traffic Out	NULL	Amount of ICP data sent

Agent G2 - Linux - Varnish Monitors

Description

Varnish application monitoring

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - Varnish Monitors	varnish.uptime	Varnish Uptime	NULL	Uptime in minutes
	varnish.client.conns.accepted	Varnish Client Connections Accepted	NULL	Average number of client connections accepted per second
	varnish.rate.esi.errors	Varnish ESI Errors	NULL	Rate of ESI parsing errors
	varnish.rate.hdrbytes	Varnish Header Size	NULL	Rate of total header size in Kbytes
	varnish.cache.hits	Varnish Cache Hits	NULL	Cache hit rate
	varnish.struct.objects	Varnish Objects	NULL	Number of objects
	varnish.backend.conns.success.ratio	Varnish Backend Connections Success Ratio	NULL	Successful backend server connections ratio
	varnish.client.connections.ratio	Varnish Client Connections Ratio	NULL	Client accepted connections to received requests ratio
	varnish.client.conns.dropped	Varnish Client Connections Dropped	NULL	Average number of client connections dropped per second
	varnish.lru.objects.moved	Varnish LRU Moved Objects	NULL	Number of LRU moved objects
	varnish.work.thread.ratio	Varnish Work Thread Ratio	NULL	Working threads to created threads ratio
	varnish.rate.sessions	Varnish Sessions	NULL	Rate of total sessions
	varnish.backend.connections	Varnish Backend Connections	NULL	Rate of backend connections success
	varnish.rate.bodybytes	Varnish Body Size	NULL	Rate of total body size in Kbytes
	varnish.abandoned.work.requests	Varnish Dropped Work Requests	NULL	Average number of abandoned work requests per second
	varnish.client.requests	Varnish Client Requests	NULL	Average number of client requests received per second
	varnish.cache.hit.ratio	Varnish Cache Hit Ratio	NULL	Cache hit ratio
	varnish.expired.objects	Varnish Expired Objects	NULL	Number of expired objects
	varnish.worker.threads	Varnish Worker Threads	NULL	Number of worker threads
	varnish.rate.requests	Varnish Requests	NULL	Rate of total received requests
	varnish.rate.fetches	Varnish Fetches	NULL	Rate of total fetches
	varnish.backend.recycle	Varnish Backend Connection Recycles	NULL	Rate of backend connection recycles
	varnish.cache.miss.ratio	Varnish Cache Miss Ratio	NULL	Cache miss ratio
	varnish.backend.req	Varnish Backend Requests	NULL	Rate of backend requests made
	varnish.lru.objects.nuked	Varnish LRU Nuked Objects	NULL	Number of LRU nuked objects
	varnish.backend.fail	Varnish Backend Connections Failed	NULL	Rate of backend connection failures
	varnish.worker.threads.failed	Varnish Failed Worker Threads	NULL	Average number of failures per second, when creating worker threads
	varnish.backend.busy	Varnish Backend Connections Busy	NULL	Rate of backend connections busy
	varnish.backend.toolate	Varnish Backend Connections Closed	NULL	Rate of backend connections closed
	varnish.cache.misses	Varnish Cache Misses	NULL	Cache miss rate

Agent G2 - Linux - WebLogic Monitors

Description

Agent G2 - Linux - WebLogic Monitors

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - WebLogic Monitors	weblogic_ejp_transactions_committed_count	Transactions Committed Count Rate	Per Second	EJB Transactions Committed Count Rate
	weblogic_ejp_access_count	Access Count Rate	Per Second	EJBPool Access Count Rate
	weblogic_jdbc_ds_curr_capacity	Curr Capacity	NULL	JDBC DataSource Curr Capacity
	weblogic_jta_transaction_rolled_back_count	JTARuntime Transaction Rolled Back Count Rate	Per Second	JTARuntime Transaction Rolled Back Count Rate
	weblogic_thread_count	Thread Count	NULL	Thread Count Of The Server
	weblogic_gc_collection_time	Collection Time	NULL	Time Taken For Collection Of The Garbage Objects
	weblogic_ejp_beans_in_use_current_count	Beans In Use Current Count	NULL	EJBPool Beans In Use Current Count
	weblogic_jdbc_ds_active_connections_current_count	Active Connections Current Count	NULL	JDBC DataSource Active Connections Current Count
	weblogic_ejp_transactions_rolled_back_count	Transactions Rolled Back Count Rate	Per Second	EJB Transactions Rolled Back Count Rate
	weblogic_jdbc_ds_leaked_connection_count	Leaked Connection Count	Per Second	JDBC DataSource Leaked Connection Count
	weblogic_ejp_pooled_beans_current_count	Pooled Beans Current Count	NULL	EJBPool Pooled Beans Current Count
	weblogic_ejp_destroyed_count	Destroyed Count Rate	Per Second	EJBPool Destroyed Count Rate
	weblogic_open_file_descriptor_count	Open File Descriptor Count	NULL	Number Of Open File Descriptors Of The Server
	weblogic_jdbc_ds_connections_count	Connections Count Rate	Per Second	JDBC DataSource Connections Count Rate
	weblogic_non_heap_memory_usage_used	Non Heap Memory Usage Used	MB	Non Heap Memory Usage Of The Server
	weblogic_thread_pool_standby_thread_count	Standby Thread Count	NULL	Standby Thread Count
	weblogic_ejp_transactions_timed_out_count	Transactions Timed Out Count Rate	Per Second	EJB Transactions Timed Out Count Rate
	weblogic_gc_collection_count	Collection Count	NULL	Number Of Garbage Objects Collected
	weblogic_heap_memory_usage_committed	Heap Memory Usage Committed	MB	Heap Memory Committed For The Server
	weblogic_uptime	WebLogic Uptime	Minutes	WebLogic Uptime
	weblogic_ejp_waiter_current_count	Waiter Current Count	NULL	EJBPool Waiter Current Count
	weblogic_total_started_thread_count	Total Started Thread Count	NULL	Total Started Thread Count
	weblogic_thread_pool_hogging_thread_count	Hogging Thread Count	NULL	Hogging Thread Count
	weblogic_jdbc_ds_waiting_for_connection_success	Waiting For Connection Success Rate	Per Second	JDBC DataSource Waiting For Connection Success Rate
	weblogic_jdbc_ds_waiting_for_connection	Waiting For Connection Rate	Per Second	JDBC DataSource Waiting For Connection Rate
	weblogic_jdbc_ds_num_available	Num Available	NULL	JDBC DataSource Num Available
	weblogic_jdbc_ds_prep_stmt_cache_current_size	Prep Stmt Cache Current Size	NULL	JDBC DataSource Prep Stmt Cache Current Size
	weblogic_thread_pool_execute_thread_idle_count	Execute Thread Idle Count	NULL	Execute Thread Idle Count
	weblogic_ejp_miss_count	Miss Count Rate	Per Second	EJBPool Miss Count Rate
	weblogic_loaded_class_count	Loaded Class Count	NULL	Loaded Class Count
	weblogic_jta_transaction_count	JTARuntime Transaction Count Rate	Per Second	JTARuntime Transaction Count Rate
	weblogic_jdbc_ds_waiting_for_connection_failure	Waiting For Connection Failure Rate	Per Second	JDBC DataSource Waiting For Connection Failure Rate
	weblogic_jta_transaction_abandoned_count	JTARuntime Transaction Abandoned Count Rate	Per Second	JTARuntime Transaction Abandoned Count Rate
	weblogic_unloaded_class_count	Unloaded Class Count	NULL	Unloaded Class Count
	weblogic_jdbc_ds_waiting_for_connection_current_count	Waiting For Connection Current Count	NULL	JDBC DataSource Waiting For Connection Current Count
	weblogic_jta_transaction_committed_count	JTARuntime Transaction Committed Count Rate	Per Second	JTARuntime Transaction Committed Count Rate
	weblogic_heap_memory_usage_used	Heap Memory Usage Used	MB	Heap Memory Usage Of The Server
	weblogic_non_heap_memory_usage_committed	Non Heap Memory Usage Committed	MB	Non Heap Memory Committed For The Server

Agent G2 - Linux - WebSphere Monitors

Description

Agent G2 - Linux - WebSphere Monitors

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - WebSphere Monitors	ibm_was_jdbc_FaultCount	JDBC Fault Count	NULL	The total number of faults, such as timeouts, in the connection pool.
	ibm_was_servlet_session_LiveCount	Servlet Session Live Count	NULL	The number of local sessions that are currently cached in memory from the time at which this metric is enabled.
	ibm_was_jdbc_CreateCount	JDBC Create Count	NULL	The total number of managed connections that were created since pool creation.
	ibm_was_servlet_session_NoRoomForNewSessionCount	Servlet Session No Room For New Session Count	NULL	Applies only to session in memory with AllowOverflow=false. The number of times that a request for a new session cannot be handled because it exceeds the maximum session count.
	ibm_was_thread_pools_ActiveTime	Thread Pools Active Time	ms	The average time in milliseconds the threads are in active state
	ibm_was_jvm_ProcessCpuUsage	JVM Process Cpu Usage Gauge	NULL	The CPU Usage (in percent) of the Java virtual machine.
	ibm_was_thread_pools_ClearedThreadHangCount	Thread Pools Cleared Thread Hang Count	NULL	The number of thread hangs cleared
	ibm_was_servlet_session_LifeTime	Servlet Session Life Time	ms	The average session life time in milliseconds (time invalidated - time created)
	ibm_was_servlet_session_ActiveCount	Servlet Session Active Count	NULL	The number of concurrently active sessions. A session is active if the WebSphere Application Server is currently processing a request that uses that session.
	ibm_was_thread_pools_DeclaredThreadHungCount	Thread Pools Declaredthread Hung Count	NULL	The number of threads declared hung
	ibm_was_thread_pools_ActiveCount	Thread Pools Active Count	NULL	The number of concurrently active threads
	ibm_was_servlet_session_CreateCount	Servlet Session Create Count	NULL	The number of sessions that were created
	ibm_was_servlet_session_CacheDiscardCount	Servlet Session Cache Discard Count	NULL	The number of session objects that have been forced out of the cache. A least recently used (LRU) algorithm removes old entries to make room for new sessions and cache misses. Applicable only for persistent sessions.
	ibm_was_jdbc_ReturnCount	JDBC Return Count	NULL	The total number of managed connections that were returned since pool creation.
	ibm_was_jvm_UsedMemory	JVM Used Memory Gauge	KB	The used memory in the JVM run time
	ibm_was_jdbc_PrepStmtCacheDiscardCount	JDBC Prep Stmt Cache Discard Count	NULL	The total number of statements that are discarded by the least recently used (LRU) algorithm of the statement cache.
	ibm_was_jdbc_FreePoolSize	JDBC Free Pool Size	NULL	The number of managed connections that are in the free pool.
	ibm_was_jvm_UpTime	JVM Up Time Gauge	Seconds	The amount of time that the JVM is running
	ibm_was_jdbc_CloseCount	JDBC Close Count	NULL	The total number of managed connections that were destroyed since pool creation.
	ibm_was_thread_pools_PoolSize	Thread Pools Pool Size	NULL	The average number of threads in pool
	ibm_was_servlet_session_InvalidateCount	Servlet Session Invalidate Count	NULL	The number of sessions that were invalidated
	ibm_was_servlet_session_ExternalWriteTime	Servlet Session External Write Time	ms	The time (milliseconds) taken to write the session data from the persistent store. Applicable only for (serialized) persistent sessions. Similar to external Read Time.
	ibm_was_jdbc_WaitTime	JDBC Wait Time	NULL	The average waiting time in milliseconds until a connection is granted if a connection is not currently available.
	ibm_was_thread_pools_CreateCount	Thread Pools Create Count	NULL	The total number of threads created
	ibm_was_jdbc_AllocateCount	JDBC Allocate Count	NULL	The total number of managed connections that were allocated since pool creation.
	ibm_was_jdbc_JDBCTime	JDBC Time	NULL	The average time in milliseconds spent running in the JDBC driver that includes time that is spent in the JDBC driver, network, and database.
	ibm_was_servlet_session_TimeSinceLastActivated	Servlet Session Time Since Last Activated	ms	The time difference in milliseconds between previous and current access time stamps. Does not include session time out.
	ibm_was_jdbc_PercentUsed	JDBC Percent Used	NULL	The percent of the pool that is in use.
	ibm_was_thread_pools_DestroyCount	Thread Pools Destroy Count	NULL	The total number of threads destroyed
	ibm_was_jdbc_WaitingThreadCount	JDBC Waiting Thread Count	NULL	The number of threads that are currently waiting for a connection.
	ibm_was_thread_pools_PercentMaxed	Thread Pools Percent Maxed	NULL	The average percent of the time that all threads are in use
	ibm_was_servlet_session_ExternalReadSize	Servlet Session External Read Size	Bytes	Size of the session data read from persistent store. Applicable only for (serialized) persistent sessions
	ibm_was_thread_pools_ConcurrentHungThreadCount	Thread Pools Concurrent Hung Thread Count	NULL	The number of concurrently hung threads
	ibm_was_jvm_FreeMemory	JVM Free Memory Gauge	KB	The free memory in the JVM run time
	ibm_was_jdbc_UseTime	JDBC Use Time	NULL	The average time in milliseconds that a connection is in use.
	ibm_was_servlet_session_ExternalWriteSize	Servlet Session External Write Size	Bytes	The size of the session data written to persistent store. Applicable only for (serialized) persistent sessions. Similar to external Read Time.
	ibm_was_servlet_session_SessionObjectSize	Servlet Session Session Object Size	Bytes	The size in bytes of (the serializable attributes of ) in-memory sessions. Only session objects that contain at least one serializable attribute object is counted. A session can contain some attributes that are serializable and some that are not. The size in bytes is at a session level.
	ibm_was_jdbc_PoolSize	JDBC Pool Size	NULL	The size of the connection pool.
	ibm_was_jdbc_PercentMaxed	JDBC Percent Maxed	NULL	The percent of the time that all connections are in use.
	ibm_was_servlet_session_TimeoutInvalidationCount	Servlet Session Timeout Invalidation Count	NULL	The number of sessions that are invalidated by timeout.
	ibm_was_servlet_session_ExternalReadTime	Servlet Session External Read Time	ms	The time (ms) taken in reading the session data from the persistent store. For multirow sessions, the metrics are for the attribute; for single row sessions, the metrics are for the entire session. Applicable only for persistent sessions. When using a JMS persistent store, only available if replicated data is serialized.
	ibm_was_jdbc_ConnectionHandleCount	JDBC Connection Handle Count	NULL	The number of connections that are in use. Can include multiple connections that are shared from a single managed connection.
	ibm_was_jdbc_ManagedConnectionCount	JDBC Managed Connection Count	NULL	The total number of managed connections in the free, shared, and unshared pools.
	ibm_was_servlet_session_AffinityBreakCount	Servlet Session Affinity Break Count	NULL	The number of requests that are received for sessions that were last accessed from another web application. This value can indicate failover processing or a corrupt plug-in configuration.
	ibm_was_jvm_HeapSize	JVM Heap Size Gauge	KB	The total memory in the JVM run time
	ibm_was_servlet_session_ActivateNonExistSessionCount	Servlet Session Activate Non Exist Session Count	NULL	The number of requests for a session that no longer exists, presumably because the session timed out. Use this counter to help determine if the timeout is too short.

Agent G2 - Linux Directory Monitor - v2

Description

Agent G2 - Linux Directory Monitor

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Linux Directory Monitor - v2	system_directory_Size	System Directory Size	GB	System Directory Size: To monitor the total size of the given directory/file path
	system_directory_file_ReadOnlyStatus	System Directory File ReadOnlyStatus	NULL	System Directory File ReadOnlyStatus - To monitor the Filtered File(s) Read Accessibility. 0 - Read Only, 1 - Other than Read Only
	system_directory_FileCount	System Directory File Count	count	System Directory File Count: To monitor the file count in a given directory based on given regex pattern
	system_directory_FileSize	System Directory File Size	KB	System Directory File Size: To monitor the each file size in a given directory path and filtering files based given regex pattern.
	system_directory_FileSizeTotal	System Directory FileSizeTotal	MB	System Directory FileSizeTotal: To monitor the total size of filtered files in a given directory based on given regex pattern.
	system_directory_Availability	System Directory Availability	NULL	System Directory Availability: To monitor the availability of given Directory/File path. Below are the possible states: 1 - Available, 0 - Not Available

Agent G2 - Linux Network Monitoring

Description

Agent G2 - Linux Network Monitoring

Prerequisites

No prerequisite

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux Network Monitor	system.network.interface.discards.in	System Network In discards	psec	Monitors Network in discards of each interface for Linux Devices
	system.network.interface.discards.out	System Network Out Discards	psec	Monitors network Out Discards of each interface for Linux Devices
	system.network.interface.errors.in	System Network In Errors	Errors per Sec	Monitors network in errors of each interface for Linux Devices
	system.network.interface.errors.out	System Network Out Errors	Errors per Sec	Monitors Network Out traffic of each interface for Linux Devices
	system.network.interface.packets.in	System Network In packets	packets/sec	Monitors in Packets of each interface for Linux Devices
	system.network.interface.packets.out	System Network out packets	packets/sec	Monitors Out packets of each interface for Linux Devices
	system.network.interface.traffic.in	System Network In traffic	Kbps	Monitors In traffic of each interface for Linux Devices
	system.network.interface.traffic.out	System Network Out Traffic	Kbps	Monitors Out traffic of each interface for Linux Devices

Agent G2 - Linux NFS Mount Point Monitoring

Description

Template to monitor linux nfs mount points availability, accessibility and utilization. This template need to assigned on all linux NFS client machines. This template tested in “CentOS7” + NFS mount points available.

Prerequisites

NFS Mount points(which are related to NFS file system) available on target device.

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux NFS Mount Point Custom Monitor	system_linux_nfs_mountpoint_accessibility	System Linux NFS Mountpoint Accessibility	NULL	System Linux NFS Mountpoint Accessibility - Below are the possible values: 1 - Read/Write access not available 0 - Read/Write access available
	system_linux_nfs_mountpoint_utilization	System Linux NFS Mountpoint Utilization	%	System Linux NFS Mountpoint Utilization
	system_linux_nfs_mountpoint_availability	System Linux NFS Mountpoint Availability	NULL	System Linux NFS Mountpoint Availability - Below are the possible values: 1 - NFS Mount Point Not Available 0 - NFS Mount Point Available

Agent G2 - Linux NFS Mount Point Monitoring - V2

Description

Template to monitor linux NFS mount points availability, accessibility and utilization and . In this version-2, mountpoint name is set as the component in both graph and alert. where as, previously in version-1 ,the component is the file system name. This template need to assigned on all linux NFS client machines.

Prerequisites

NFS Mount points(which are related to NFS file system) available on target device.

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux NFS Mount Point Custom Monitor-V2	system_linux_nfs_mountpoint_accessibility	System Linux NFS Mountpoint Accessibility		System Linux NFS Mountpoint Accessibility - Below are the possible values: 1 - Read/Write access not available 0 - Read/Write access available
	system_linux_nfs_mountpoint_utilization	System Linux NFS Mountpoint Utilization	%	System Linux NFS Mountpoint Utilization
	system_linux_nfs_mountpoint_availability	System Linux NFS Mountpoint Availability		System Linux NFS Mountpoint Availability - Below are the possible values: 1 - NFS Mount Point Not Available 0 - NFS Mount Point Available

Agent G2 - Linux NFS Mount Point Monitoring - v3

Description

Template to monitor Linux NFS mount points availability, accessibility and utilization. This template need to assigned on all linux NFS client machines.

Prerequisites

NFS Mount points(which are related to NFS file system) available on target device.

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux NFS Mount Point Custom Monitor - v3	system_linux_nfs_mountpoint_accessibility	System Linux NFS Mountpoint Accessibility		System Linux NFS Mountpoint Accessibility - Below are the possible values: 1 - Read/Write access not available 0 - Read/Write access available
	system_linux_nfs_mountpoint_utilization	System Linux NFS Mountpoint Utilization	%	System Linux NFS Mountpoint Utilization
	system_linux_nfs_mountpoint_availability	System Linux NFS Mountpoint Availability		System Linux NFS Mountpoint Availability - Below are the possible values: 1 - NFS Mount Point Not Available 0 - NFS Mount Point Available

Agent G2 - Linux OS File Systems Monitoring

Description

Template to monitor Linux OS advanced performance metrics related to File systems (space, Inodes utilization and change in mount status of a file system). It has been validated on following Linux flavors: RHEL 7.9, Centos 7 ,Ubuntu 20.04, Open SUSE Linux.

Prerequisites

Applicable on devices which is running Opsramp Agent ( v7.0.0 or above)

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux File Systems	system_linux_fileSystem_Inodes_Usage_Number	System Linux FileSystem Inodes Usage Number	count	File system Inodes usage number.
	system_linux_fileSystem_Inodes_Delta	System Linux FileSystem Inodes Delta	count	File system Inodes usage delta.
	system_linux_fileSystem_Space_UsedInMB	System Linux FileSystem Space Used In MB	MB	File system space usage in MB
	system_linux_fileSystem_Space_DeltaInKB	System Linux FileSystem Space Delta In KB	KB	File system space usage(KB) delta
	system_linux_fileSystem_Inodes_Utilization	System Linux FileSystem Inodes Utilization	%	File system Inodes utilization percent.
Agent G2 - Linux File Systems Mount Change Detection	system_linux_fileSystem_Mount_ChangeDetection	System Linux Filesystem Mount Change Detection		File system mount point change detection. It detects if any file system mount point removed and if any new mount point added into the system. Below are the possible values: 0 - Available, 1 - Newly Added, 2 - Removed

Agent G2 - Linux OS File Systems Monitoring - V2

Description

Template to monitor Linux OS advanced performance metrics related to File systems (Network and Local) (space, Inodes utilization and change in mount status of a file system). It has been validated on following Linux flavors: RHEL 7.9, Centos 7 ,Ubuntu 20.04, Open SUSE Linux.

Prerequisites

Applicable on devices which is running OpsRamp Agent ( v7.0.0 or above)

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux File Systems - V2	system_linux_fileSystem_Inodes_Usage_Number	System Linux FileSystem Inodes Usage Number	count	File system Inodes usage number.
	system_linux_fileSystem_Inodes_Delta	System Linux FileSystem Inodes Delta	count	File system Inodes usage delta.
	system_linux_fileSystem_Space_UsedInMB	System Linux FileSystem Space Used In MB	MB	File system space usage in MB
	system_linux_fileSystem_Space_DeltaInKB	System Linux FileSystem Space Delta In KB	KB	File system space usage(KB) delta
	system_linux_fileSystem_Inodes_Utilization	System Linux FileSystem Inodes Utilization	%	File system Inodes utilization percent.
Agent G2 - Linux File Systems Mount Change Detection - V2	system_linux_fileSystem_Mount_ChangeDetection	System Linux Filesystem Mount Change Detection		File system mount point change detection. It detects if any file system mount point removed and if any new mount point added into the system. Below are the possible values: 0 - Available, 1 - Newly Added, 2 - Removed

Agent G2 - Linux OS File Systems Monitoring - v3

Description

Prerequisites

Applicable on devices which is running OpsRamp Agent ( v7.0.0 or above)

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux File Systems - V2	system_linux_fileSystem_Inodes_Usage_Number	System Linux FileSystem Inodes Usage Number	count	File system Inodes usage number.
	system_linux_fileSystem_Inodes_Delta	System Linux FileSystem Inodes Delta	count	File system Inodes usage delta.
	system_linux_fileSystem_Space_UsedInMB	System Linux FileSystem Space Used In MB	MB	File system space usage in MB
	system_linux_fileSystem_Space_DeltaInKB	System Linux FileSystem Space Delta In KB	KB	File system space usage(KB) delta
	system_linux_fileSystem_Inodes_Utilization	System Linux FileSystem Inodes Utilization	%	File system Inodes utilization percent.
Agent G2 - Linux File Systems Mount Change Detection - V3	system_linux_fileSystem_Mount_ChangeDetection	System Linux Filesystem Mount Change Detection		File system mount point change detection. It detects if any file system mount point removed and if any new mount point added into the system. Below are the possible values: 0 - Available, 1 - Newly Added, 2 - Removed

Agent G2 - Linux OS File Systems Monitoring - v4

Description

Agent G2 - Linux OS File Systems Monitoring - v4

Prerequisites

Applicable on devices which is running OpsRamp Agent ( v7.0.0 or above)

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux File Systems - v4	system_linux_fileSystem_Inodes_Usage_Number	System Linux FileSystem Inodes Usage Number	count	File system Inodes usage number.
	system_linux_fileSystem_Inodes_Delta	System Linux FileSystem Inodes Delta	count	File system Inodes usage delta.
	system_linux_fileSystem_Space_UsedInMB	System Linux FileSystem Space Used In MB	MB	File system space usage in MB
	system_linux_fileSystem_Space_DeltaInKB	System Linux FileSystem Space Delta In KB	KB	File system space usage(KB) delta
	system_linux_fileSystem_Inodes_Utilization	System Linux FileSystem Inodes Utilization	%	File system Inodes utilization percent.
Agent G2 - Linux File Systems Mount Change Detection - v4	system_linux_fileSystem_Mount_ChangeDetection	System Linux Filesystem Mount Change Detection		File system mount point change detection. It detects if any file system mount point removed and if any new mount point added into the system. Below are the possible values: 0 - Available, 1 - Newly Added, 2 - Removed

Agent G2 - Linux OS Mount Point Monitoring

Description

Template to monitor Linux OS advanced performance metrics related to Mount Points (space,Inodes utilization and Availability status of mount point). It has been validated on following Linux flavors: RHEL 7.9, Centos 7 ,Ubuntu 20.04, Open SUSE Linux.

Prerequisites

Applicable on devices which is running Opsramp Agent ( v7.0.0 or above)

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux Mount Points	system_linux_mountpoint_Space_DeltaInKB	System Linux Mount Point Space Delta In KB	KB	Mount point space usage(KB) delta
	system_linux_mountpoint_Inodes_Usage_Number	System Linux Mount Point Inodes Usage Number	count	Mount point Inodes usage number.
	system_linux_mountpoint_Availability_Status	System Linux Mount Point Availability Status		Availability status of mount point. These are possible values: 0 - Not Available, 1 - Available
	system_linux_mountpoint_Space_UsedInMB	System Linux Mount Point Space Used In MB	MB	Mount point usage in MB
	system_linux_mountpoint_Inodes_Utilization	System Linux Mount Point Inodes Utilization	%	Mount point Inodes utilization percent.
	system_linux_mountpoint_Inodes_Delta	System Linux Mount Point Inodes Delta	count	Mount point Inodes usage delta.

Agent G2 - Linux OS Mount Point Monitoring - V2

Description

Prerequisites

Applicable on devices which is running Opsramp Agent ( v7.0.0 or above)

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux Mount Points - V2	system_linux_mountpoint_Space_DeltaInKB	System Linux Mount Point Space Delta In KB	KB	Mount point space usage(KB) delta
	system_linux_mountpoint_Inodes_Usage_Number	System Linux Mount Point Inodes Usage Number	count	Mount point Inodes usage number.
	system_linux_mountpoint_Availability_Status	System Linux Mount Point Availability Status		Availability status of mount point. These are possible values: 0 - Not Available, 1 - Available
	system_linux_mountpoint_Space_UsedInMB	System Linux Mount Point Space Used In MB	MB	Mount point usage in MB
	system_linux_mountpoint_Inodes_Utilization	System Linux Mount Point Inodes Utilization	%	Mount point Inodes utilization percent.
	system_linux_mountpoint_Inodes_Delta	System Linux Mount Point Inodes Delta	count	Mount point Inodes usage delta.

Agent G2 - Linux OS Performance Monitoring

Description

Agent G2 - Linux OS Performance Monitoring

Prerequisites

No prerequisite

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - CPU Monitor	system.cpu.usage.utilization	System CPU Utilization	%	The percentage of elapsed time that the processor spends to execute a non-Idle thread(This doesn't includes CPU steal time)
Agent G2 - Disk Monitor	system.disk.usage.freespace	System FreeDisk Usage	GB	Monitors the Free Space usage in GB
	system.disk.usage.usedspace	System Disk UsedSpace	GB	Monitors disk used space in GB
	system.disk.usage.utilization	System Disk Utilization	%	Monitors disk utilization in percentage
Agent G2 - Memory Monitor	system.memory.usage.usedspace	System Memory Used Space	GB	Physical and virtual memory usage in GB
Agent G2 - Memory Monitor	system.memory.usage.utilization	System Memory Utilization	%	Physical and virtual memory usage in percentage.
Agent G2 - Uptime Monitor	system.os.uptime	System Uptime	m	Time lapsed since last reboot in minutes
Agent G2 - Linux CPU Load Monitor	system.cpu.load	System CPU Load		Monitors the system's last 1min, 5min and 15min load. It sends per cpu core load average.
Agent G2 - Linux CPU Statistics Monitor	system.cpu.usage.stats	System CPU Usage Statistics	%	Monitors cpu time in percentage spent in various program spaces.\n\nUser - The processor time spent running user space processes \nSystem - The amount of time that the CPU spent running the kernel.\nIOWait - The time the CPU spends idle while waiting for an I/O operation to complete\nIdle - The time the processor spends idle\nSteal - The time virtual CPU has spent waiting for the hypervisor to service another virtual CPU running on a different virtual machine.\nKernal Time\nTotal Time
Agent G2 - Linux Disk Inode Utilization Monitor	system.disk.inode.utilization	System Disk Inode Utilization	%	This monitor is to collect DISK Inode metrics for all physical disks in a server.

Agent G2 - Logfile Monitoring

Description

The Logfile monitor is used to validate whether the given input string is found or not in the specified input logfile. It sends an alert based on the check type (yes or no), and regex patterns are also allowed in the input string. We have added support for alert tokens in G2 logfile monitoring. In the global template, we have included all tokens, and customers can choose the required tokens based on their requirements.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 Logfile Monitor	system_logfile_search_monitor	system_logfile_search_monitor		Using logfile monitor to validate given input string is found or not by from given input logfile and sends the alerts

Agent G2 - Microsoft Active Directory 2003 - Performance Counters

Description

Template for AD 2003 Servers.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Active Directory 2003 - Performance Counters	DSServerBindsPersec	DSServerBindsPersec		Shows the number of DC-to-DC binds per second that are serviced by this DC.
	LDAPClientSessions	LDAPClientSessions		The number of sessions of connected LDAP clients. Lack of activity points to network problems.
	DRAOutboundObjectsPersec	DRAOutboundObjectsPersec		The number of objects sent (per second) through outbound replication to replication partners.
	ABClientSessions	ABClientSessions		AB Client Sessions is the number of connected Address Book client sessions.
	DRAInboundObjectsPersec	DRAInboundObjectsPersec		The number of objects received (per second) through inbound replication from replication partners.
	DRAInboundObjectsAppliedPersec	DRAInboundObjectsAppliedPersec		This counter excludes changes that are received but not applied (for example, when the update is already made) and also how many replication updates are occurring on the server as a result of changes generated on other servers.
	KerberosAuthentications	KerberosAuthentications		The number of times per second that clients use a client ticket to this domain controller to authenticate to this domain controller. A lack of activity can indicate network problems that are preventing authentication requests from succeeding.
	DRAInboundObjectUpdatesRemaininginPacket	DRAInboundObjectUpdatesRemaininginPacket		This counter tells you whether the monitored server is receiving changes, but is taking a long time applying them to the database. The value should be low, with a higher value indicating that the hardware is incapable of adequately servicing replication (warranting a server upgrade).
	NTLMAuthentications	NTLMAuthentications		The number of NTLM authentications (per second) serviced by this domain controller
	LDAPSearchesPersec	LDAPSearchesPersec		The number of search operations per second performed by LDAP clients. A lack of activity points to network problems.
	DSDirectoryReadsPersec	DSDirectoryReadsPersec		Shows the number of directory reads per second.
	DSDirectoryWritesPersec	DSDirectoryWritesPersec		Shows the number of directory writes per second.
	LDAPActiveThreads	LDAPActiveThreads		LDAP Active Threads is the current number of threads in use by the LDAP subsystem of the local direcotry service.
	LDAPWritesPersec	LDAPWritesPersec		Shows the rate at which LDAP clients perform write operations.
	DRAOutboundBytesTotalPersec	DRAOutboundBytesTotalPersec	Bytes per second	It is the sum of the number of bytes of uncompressed data (never compressed) and compressed data (after compression) sent per second. Lack of activity indicates that the hardware or network is slowing down replication.
	DSNotifyQueueSize	DSNotifyQueueSize		The number of pending update notifications that have been queued, but not yet transmitted to clients.
	DRAInboundBytesTotalPersec	DRAInboundBytesTotalPersec	Bytes per second	It is the sum of the number of bytes (per second) of uncompressed data (never compressed) and compressed data (after compression) received through replication. Lack of activity indicates that the network is slowing down replication.
	LDAPUDPoperationsPersec	LDAPUDPoperationsPersec		Shows the number of UDP operations that the LDAP server is processing per second.
	LDAPBindTime	LDAPBindTime	Milliseconds	This counter shows the time required for completion of the last LDAP binding, with a higher value pointing to either hardware or network performance problems.
	DSClientBindsPersec	DSClientBindsPersec		Shows the number of Ntdsapi.dll binds per second serviced by this DC.
	DRAPendingReplicationSynchronizations	DRAPendingReplicationSynchronizations		The number of directory synchronizations that are queued for this server that are not yet processed. This counter helps in determining replication backlog - the larger the number, the larger the backlog. This value should be low, with a higher value indicating that the hardware is not adequately servicing replication.

Agent G2 - Microsoft Active Directory 2008 - Performance Counters

Description

Template for AD 2008 Servers.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Active Directory 2008 - Performance Counters	LDAPWritesPersec	LDAPWritesPersec		Shows the rate at which LDAP clients perform write operations.
	NTLMAuthentications	NTLMAuthentications		The number of NTLM authentications (per second) serviced by this domain controller
	LDAPClientSessions	LDAPClientSessions		The number of sessions of connected LDAP clients. Lack of activity points to network problems.
	ABClientSessions	ABClientSessions		AB Client Sessions is the number of connected Address Book client sessions.
	DSClientBindsPersec	DSClientBindsPersec		Shows the number of Ntdsapi.dll binds per second serviced by this DC.
	LDAPActiveThreads	LDAPActiveThreads		LDAP Active Threads is the current number of threads in use by the LDAP subsystem of the local directory service.
	LDAPUDPoperationsPersec	LDAPUDPoperationsPersec		Shows the number of UDP operations that the LDAP server is processing per second.
	LDAPBindTime	LDAPBindTime	Milliseconds	This counter shows the time required for completion of the last LDAP binding, with a higher value pointing to either hardware or network performance problems.
	DRAOutboundObjectsPersec	DRAOutboundObjectsPersec		The number of objects sent (per second) through outbound replication to replication partners.
	DRAInboundObjectsPersec	DRAInboundObjectsPersec		The number of objects received (per second) through inbound replication from replication partners.
	DRAPendingReplicationSynchronizations	DRAPendingReplicationSynchronizations		The number of directory synchronizations that are queued for this server that are not yet processed. This counter helps in determining replication backlog - the larger the number, the larger the backlog. This value should be low, with a higher value indicating that the hardware is not adequately servicing replication.
	DSNotifyQueueSize	DSNotifyQueueSize		The number of pending update notifications that have been queued, but not yet transmitted to clients.
	DSServerBindsPersec	DSServerBindsPersec		Shows the number of DC-to-DC binds per second that are serviced by this DC.
	DSDirectoryReadsPersec	DSDirectoryReadsPersec		Shows the number of directory reads per second.
	DRAInboundObjectUpdatesRemaininginPacket	DRAInboundObjectUpdatesRemaininginPacket		This counter tells you whether the monitored server is receiving changes, but is taking a long time applying them to the database. The value should be low, with a higher value indicating that the hardware is incapable of adequately servicing replication (warranting a server upgrade).
	KerberosAuthentications	KerberosAuthentications		The number of times per second that clients use a client ticket to this domain controller to authenticate to this domain controller. A lack of activity can indicate network problems that are preventing authentication requests from succeeding.
	DRAInboundObjectsAppliedPersec	DRAInboundObjectsAppliedPersec		This counter excludes changes that are received but not applied (for example, when the update is already made) and also how many replication updates are occurring on the server as a result of changes generated on other servers.
	LDAPSearchesPersec	LDAPSearchesPersec		The number of search operations per second performed by LDAP clients. A lack of activity points to network problems.
	DSDirectoryWritesPersec	DSDirectoryWritesPersec		Shows the number of directory writes per second.
	DRAOutboundBytesTotalPersec	DRAOutboundBytesTotalPersec	Bytes per second	It is the sum of the number of bytes of uncompressed data (never compressed) and compressed data (after compression) sent per second. Lack of activity indicates that the hardware or network is slowing down replication.
	DRAInboundBytesTotalPersec	DRAInboundBytesTotalPersec	Bytes per second	It is the sum of the number of bytes (per second) of uncompressed data (never compressed) and compressed data (after compression) received through replication. Lack of activity indicates that the network is slowing down replication.

Agent G2 - Microsoft Active Directory 2012 DotNet v4 - Performance Counters

Description

Monitors Microsoft Active Directory Performance Counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Active Directory 2012 DotNet v4 - Performance Counters	LDAPWritesPersec	LDAPWritesPersec		Shows the rate at which LDAP clients perform write operations.
	DRAOutboundBytesTotalPersec	DRAOutboundBytesTotalPersec	Bytes per second	It is the sum of the number of bytes of uncompressed data (never compressed) and compressed data (after compression) sent per second. Lack of activity indicates that the hardware or network is slowing down replication.
	DSClientBindsPersec	DSClientBindsPersec		Shows the number of Ntdsapi.dll binds per second serviced by this DC.
	LDAPClientSessions	LDAPClientSessions		The number of sessions of connected LDAP clients. Lack of activity points to network problems.
	DRAInboundObjectsPersec	DRAInboundObjectsPersec		The number of objects received (per second) through inbound replication from replication partners.
	DSDirectoryReadsPersec	DSDirectoryReadsPersec		Shows the number of directory reads per second.
	LDAPUDPoperationsPersec	LDAPUDPoperationsPersec		Shows the number of UDP operations that the LDAP server is processing per second.
	LDAPActiveThreads	LDAPActiveThreads		LDAP Active Threads is the current number of threads in use by the LDAP subsystem of the local directory service.
	LDAPSearchesPersec	LDAPSearchesPersec		The number of search operations per second performed by LDAP clients. A lack of activity points to network problems.
	LDAPBindTime	LDAPBindTime	Milliseconds	This counter shows the time required for completion of the last LDAP binding, with a higher value pointing to either hardware or network performance problems.
	DSDirectoryWritesPersec	DSDirectoryWritesPersec		Shows the number of directory writes per second.
	DRAPendingReplicationSynchronizations	DRAPendingReplicationSynchronizations		The number of directory synchronizations that are queued for this server that are not yet processed. This counter helps in determining replication backlog - the larger the number, the larger the backlog. This value should be low, with a higher value indicating that the hardware is not adequately servicing replication.
	ABClientSessions	ABClientSessions		AB Client Sessions is the number of connected Address Book client sessions.
	DSServerBindsPersec	DSServerBindsPersec		Shows the number of DC-to-DC binds per second that are serviced by this DC.
	DRAInboundBytesTotalPersec	DRAInboundBytesTotalPersec	Bytes per second	It is the sum of the number of bytes (per second) of uncompressed data (never compressed) and compressed data (after compression) received through replication. Lack of activity indicates that the network is slowing down replication.
	DSNotifyQueueSize	DSNotifyQueueSize		The number of pending update notifications that have been queued, but not yet transmitted to clients.
	DRAInboundObjectsAppliedPersec	DRAInboundObjectsAppliedPersec		This counter excludes changes that are received but not applied (for example, when the update is already made) and also how many replication updates are occurring on the server as a result of changes generated on other servers.
	DRAInboundObjectUpdatesRemaininginPacket	DRAInboundObjectUpdatesRemaininginPacket		This counter tells you whether the monitored server is receiving changes, but is taking a long time applying them to the database. The value should be low, with a higher value indicating that the hardware is incapable of adequately servicing replication (warranting a server upgrade).
	DRAOutboundObjectsPersec	DRAOutboundObjectsPersec		The number of objects sent (per second) through outbound replication to replication partners.

Agent G2 - Microsoft Active Directory 2019 DotNet v4- Performance Counters

Description

Monitors Microsoft Active Directory Performance Counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Active Directory 2019 DotNet v4- Performance Counters	DSNotifyQueueSize	DSNotifyQueueSize		The number of pending update notifications that have been queued, but not yet transmitted to clients.
	DSServerBindsPersec	DSServerBindsPersec		Shows the number of DC-to-DC binds per second that are serviced by this DC.
	DRAOutboundBytesTotalPersec	DRAOutboundBytesTotalPersec	Bytes per second	It is the sum of the number of bytes of uncompressed data (never compressed) and compressed data (after compression) sent per second. Lack of activity indicates that the hardware or network is slowing down replication.
	DRAPendingReplicationSynchronizations	DRAPendingReplicationSynchronizations		The number of directory synchronizations that are queued for this server that are not yet processed. This counter helps in determining replication backlog - the larger the number, the larger the backlog. This value should be low, with a higher value indicating that the hardware is not adequately servicing replication.
	DRAInboundObjectsAppliedPersec	DRAInboundObjectsAppliedPersec		This counter excludes changes that are received but not applied (for example, when the update is already made) and also how many replication updates are occurring on the server as a result of changes generated on other servers.
	DSDirectoryWritesPersec	DSDirectoryWritesPersec		Shows the number of directory writes per second.
	DRAInboundBytesTotalPersec	DRAInboundBytesTotalPersec	Bytes per second	It is the sum of the number of bytes (per second) of uncompressed data (never compressed) and compressed data (after compression) received through replication. Lack of activity indicates that the network is slowing down replication.
	DSDirectoryReadsPersec	DSDirectoryReadsPersec		Shows the number of directory reads per second.
	LDAPBindTime	LDAPBindTime	Milliseconds	This counter shows the time required for completion of the last LDAP binding, with a higher value pointing to either hardware or network performance problems.
	LDAPClientSessions	LDAPClientSessions		The number of sessions of connected LDAP clients. Lack of activity points to network problems.
	DRAOutboundObjectsPersec	DRAOutboundObjectsPersec		The number of objects sent (per second) through outbound replication to replication partners.
	LDAPWritesPersec	LDAPWritesPersec		Shows the rate at which LDAP clients perform write operations.
	DRAInboundObjectUpdatesRemaininginPacket	DRAInboundObjectUpdatesRemaininginPacket		This counter tells you whether the monitored server is receiving changes, but is taking a long time applying them to the database. The value should be low, with a higher value indicating that the hardware is incapable of adequately servicing replication (warranting a server upgrade).
	LDAPSearchesPersec	LDAPSearchesPersec		The number of search operations per second performed by LDAP clients. A lack of activity points to network problems.
	ABClientSessions	ABClientSessions		AB Client Sessions is the number of connected Address Book client sessions.
	DSClientBindsPersec	DSClientBindsPersec		Shows the number of Ntdsapi.dll binds per second serviced by this DC.
	LDAPActiveThreads	LDAPActiveThreads		LDAP Active Threads is the current number of threads in use by the LDAP subsystem of the local directory service.
	DRAInboundObjectsPersec	DRAInboundObjectsPersec		The number of objects received (per second) through inbound replication from replication partners.
	LDAPUDPoperationsPersec	LDAPUDPoperationsPersec		Shows the number of UDP operations that the LDAP server is processing per second.

Agent G2 - Microsoft DotNet Performance Counters DotNet v4

Description

Monitors Microsoft DotNet Performance Counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft DotNet Performance Counters DotNet v4	netclr.numberof.current.physicalthreads	NETCLR Number of Current Physical Threads		Shows the number of native OS threads created and owned by the CLR to act as underlying threads for .NET thread objects. This counter's value does not include the threads used by the CLR in its internal operations; it is a subset of the threads in the OS process.
	aspnet.requests.current	ASPNET Requests Current		Shows the current number of requests, including those that are queued, currently executing, or waiting to be written to the client. Under the ASP.NET process model, when this counter exceeds the requestQueueLimit defined in the processModel configuration section, ASP.NET will begin rejecting requests.
	aspnet.request.wait.time	ASPNET Request Wait Time	MS	Shows the number of milliseconds the most recent request was waiting in the queue.
	netclr.current.queue.length	NETCLR Current Queue Length		Shows the total number of threads currently waiting to acquire some managed lock in the application. This counter is not an average over time; it displays the last observed value.
	netclr.numberofexceps.thrown.persec	NETCLR Number of Exceps Thrown Per sec		Shows the number of exceptions thrown per second. These include both .NET exceptions and unmanaged exceptions that get converted into .NET exceptions e.g. null pointer reference exception in unmanaged code would get re-thrown in managed code as a .NET System.NullReferenceException; this counter includes both handled and unhandled exceptions.
	webservice.get.requests.persec	Web Service Get Requests Per sec		Shows the rate HTTP requests using the GET method are made. Get requests are the most common HTTP request.
	netclr.numberof.current.logicalthreads	NETCLR Number of Current Logical Threads		Shows the number of current .NET thread objects in the application. A .NET thread object is created either by new System.Threading.Thread or when an unmanaged thread enters the managed environment. This counter maintains the count of both running and stopped threads. This counter is not an average over time; it just displays the last observed value.
	webservice.current.connections	Web Service Current Connections		Shows the current number of connections established with the Web service.
	netclr.contention.rate.persec	NETCLR Contention Rate Per sec		Rate at which threads in the runtime attempt to acquire a managed lock unsuccessfully. Managed locks can be acquired in many ways; by the "lock" statement in C# or by calling System.Monitor. Enter or by using MethodImplOptions.Synchronized custom attribute.
	webservice.post.requests.persec	Web Service Post Requests Per sec		Shows the rate HTTP requests using the POST method are made.

Agent G2 - Microsoft Exchange 2007 - Server Role - Client Access Servers (CAS) DotNet v4

Description

Applicable on Exchange Servers with the CAS role

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Description
Agent G2 - Microsoft Exchange 2007 - Server Role - Client Access Servers DotNet v4	SyncCommandsPersec	Sync Commands Per sec	Sync Commands/sec is the number of Sync commands that are processed per second. Clients use this command to synchronize items within a folder.
	DownloadTasksCompleted	Download Tasks Completed	Download Tasks Completed is the number of OAB download tasks completed.
	OWARequestsPersec	OWA Requests Per sec	Requests/sec is the number of requests handled by Outlook Web App per second.
	DownloadTaskQueued	Download Task Queued	Download Task Queued is one(1) if task is queued for execution, otherwise zero(0).
	AverageSearchTime	Average Search Time	Average Search Time is the average time that elapsed while waiting for a search to complete.
	CurrentConnections	Current Connections	The number of active connections to the WWW service.
	AverageTimetoProcessaFreeBusyRequest	Average Time to Process a Free Busy Request	Average Time to Process a Free Busy Request is the average time to process a free busy request in seconds. One request may contain multiple mailboxes. Free busy responses do not have meeting suggestions.
	AverageResponseTime	Average Response Time	Average Response Time is the average time (in milliseconds) that elapsed between the beginning and end of an OEH or ASPX request.
	ActiveSyncRequestsPersec	ActiveSync Requests Per sec	Shows the number of HTTP requests that are received from the client via ASP.NET per second.
	AvailabilityRequestssec	Availability Requests per sec	Availability Requests per second is the number of requests serviced per second. The request can be only for free busy or include suggestions. One request may contain multiple mailboxes.

Agent G2 - Microsoft Exchange 2007 - Server Role - Client Access Servers ASPNET (CAS ASPNET) DotNet v4

Description

Applicable on Exchange Servers with CAS ASPNET role

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Description
Agent G2 - Microsoft Exchange 2007 - Server Role - Client Access Servers ASPNET DotNet v4	RequestWaitTime	Request Wait Time	RPC Requests outstanding is the current number of outstanding RPC requests.
	WorkerProcessRestarts	Worker Process Restarts	Number of times a worker process has restarted on the machine.
	RequestsCurrent	Requests Current	The current number of requests both executing and queued.
	ApplicationRestarts	Application Restarts	Number of times the application has been restarted during the web server lifetime.
	RequestsInApplicationQueue	Requests In Application Queue	The current number of requests, including those that are queued, currently executing, or waiting to be written to the client. Under the ASP.NET process model, when this counter exceeds the requestQueueLimit defined in the processModel configuration section, ASP.NET will begin rejecting requests.

Agent G2 - Microsoft Exchange 2007 - Server Role - Edge Transport Server (ETS) DotNet v4

Description

Applicable on Exchange Servers with the ETS role

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2007 - Server Role - Edge Transport Server DotNet v4	LogThreadsWaiting	Log Threads Waiting		Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the number of threads waiting for their data to be written to the log to complete an update of the database. If this number is too high, the log may be a bottleneck. This value should be less than 10 on average. Regular spikes concurrent with log record stall spikes indicate that the transaction log disks are a bottleneck. If the value for log threads waiting is more than the spindles available for the logs, there is a bottleneck on the log disks.
	IODatabaseReadsPersec	IO Database Reads Per sec		I/O Database Reads/sec is the rate of database read operations completed.
	RetryRemoteDeliveryQueueLength	Retry Remote Delivery Queue Length		Retry Remote Delivery Queue Length is the number of messages in retry in the remote delivery queues.
	SubmissionQueueLength	Submission Queue Length		The number of items in the submission queue when sample was taken.
	LargestDeliveryQueueLength	Largest Delivery Queue Length		The number of items in the largest delivery queue.
	AggregateDeliveryQueueLengthAllQueues	Aggregate Delivery Queue Length All Queues		The number of messages queued for aggregate delivery.
	Versionbucketsallocated	Version Buckets Allocated		It provides the total number of version buckets allocated.
	ActiveRemoteDeliveryQueueLength	Active Remote Delivery Queue Length		The number of messages queued for remote delivery.
	LogRecordStallsPersec	Log Record Stalls Per sec		Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the number of log records that cannot be added to the log buffers per second because the log buffers are full. If this counter is non-zero most of the time, the log buffer size may be a bottleneck. If I/O log write latencies are high, check for RAID5 or sync replication on log devices. The average value should be below 10 per second. Spikes (maximum values) should not be higher than 100 per second.
	PoisonQueueLength	Poison Queue Length		The number of messages in the poison message queue.
	IODatabaseWritesPersec	IO Database Writes Per sec		I/O Database Writes/sec is the rate of database write operations completed.
	DatabaseCachePercentHit	Database Cache Percent Hit	%	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the percentage of database file page requests that were fulfilled by the database cache without causing a file operation. If this percentage is too low, the database cache size may be too small. This value should be over 90% for companies with majority online mode clients. It should be over 99% for companies with majority cached mode clients. If the hit ratio is less than these numbers, the database cache may be insufficient.
	UnreachableQueueLength	Unreachable Queue Length		The number of messages in Unreachable Queue when sample was taken.

Agent G2 - Microsoft Exchange 2007 - Server Role - HUB Transport Servers (HTS) DotNet v4

Description

Applicable on Exchange Servers with the HTS role

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Description
Agent G2 - Microsoft Exchange 2007 - Server Role - HUB Transport Servers DotNet v4	ActiveNonSmtpDeliveryQueueLength	Active Non-SMTP Delivery Queue Length	The number of messages queued for delivery to a Non-SMTP transport. The value format is a 4-byte integer.
	RetryNonSmtpDeliveryQueueLength	Retry Non-SMTP Delivery Queue Length	Assures the number of messages currently in the retry non-SMTP delivery queue. Messages in this queue are in a retry state because an issue prevented their delivery. If the issue is transient, a subsequent reattempt to send the message may be successful. A queue length < 200 can be considered as Ok.
	ActiveMailboxDeliveryQueueLength	Active Mailbox Delivery Queue Length	The number of messages queued for delivery to an active mailbox. The value format is a 4-byte integer.
	MessagesCompletedDeliveryPerSecond	Messages Completed Delivery Per Second	This monitor is useful in assessing the efficiency and efficacy of the current design. They also provide insight into the interaction between different transport components, including the information store interface. It shows the number of messages that are delivered per second.
	RetryMailboxDeliveryQueueLength	Retry Mailbox Delivery Queue Length	Measures the number of messages currently in the retry mailbox delivery queue. Messages in this queue are in a retry state because an issue prevented their delivery. If the issue is transient, a subsequent attempt to send the message may be successful. A queue length < 200 can be considered as OK.
	MessagesQueuedforDeliveryPerSecond	Messages Queued for Delivery Per Second	This monitor is useful in assessing the efficiency and efficacy of the current design. They also provide insight into the interaction between different transport components, including the information store interface. It shows the number of messages that have been queued for delivery per second.
	MessagesSubmittedPerSecond	Messages Submitted Per Second	This monitor is useful in assessing the efficiency and efficacy of the current design. They also provide insight into the interaction between different transport components, including the information store interface. It shows the number of messages that have been queued in the Submission queue per second.
	SubmissionQueueLength	Submission Queue Length	The number of items in the submission queue when the sample was taken.
	IODatabaseWritesPersec	IO Database Writes Per sec	I/O Database Writes/sec is the rate of database write operations completed.
	MessagesQueuedforDeliveryPerSecond	Messages Queued for Delivery Per Second	This monitor is useful in assessing the efficiency and efficacy of the current design. They also provide insight into the interaction between different transport components, including the information store interface. It shows the number of messages that have been queued for delivery per second.
	LogRecordStallsPersec	Log Record Stalls Per sec	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the number of log records that cannot be added to the log buffers per second because the log buffers are full. If this counter is non-zero most of the time, the log buffer size may be a bottleneck. If I/O log write latencies are high, check for RAID5 or sync replication on log devices. The average value should be below 10 per second. Spikes (maximum values) should not be higher than 100 per second.
	AggregateDeliveryQueueLengthAllQueues	Aggregate Delivery Queue Length All Queues	The number of messages queued for aggregate delivery.
	IODatabaseReadsPersec	IO Database Reads Per sec	I/O Database Reads/sec is the rate of database read operations completed.
	PoisonQueueLength	Poison Queue Length	The number of messages in the poison message queue.
	LargestDeliveryQueueLength	Largest Delivery Queue Length	The number of items in the largest delivery queue.
	LogThreadsWaiting	Log Threads Waiting	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the number of threads waiting for their data to be written to the log to complete an update of the database. If this number is too high, the log may be a bottleneck. This value should be less than 10 on average. Regular spikes concurrent with log record stall spikes indicate that the transaction log disks are a bottleneck. If the value for log threads waiting is more than the spindles available for the logs, there is a bottleneck on the log disks.
	ActiveRemoteDeliveryQueueLength	Active Remote Delivery Queue Length	The number of messages queued for remote delivery.
	UnreachableQueueLength	Unreachable Queue Length	The number of messages in Unreachable Queue when the sample was taken.

Agent G2 - Microsoft Exchange 2007 - Server Role - Mailbox Servers (MBS) DotNet v4

Description

Applicable on Exchange Servers with the MBS role

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2007 - Server Role - Mailbox Servers DotNet v4	IODatabaseWritesAverageLatency	IO Database Writes Average Latency		Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the average length of time, in milliseconds, per database write operation.
	DatabaseCachePercentHit	Database Cache Percent Hit	%	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the percentage of database file page requests that were fulfilled by the database cache without causing a file operation. If this percentage is too low, the database cache size may be too small. This value should be over 90% for companies with a majority online mode clients. It should be over 99% for companies with majority cached mode clients. If the hit ratio is less than these numbers, the database cache may be insufficient.
	RPCLatencyaveragemsec	RPC Latency Average msec		Exchange communicates with Hub Transport servers via RPC. This counter is useful in isolating and determining issues involving the interface between the Microsoft Exchange Information Store service on the Mailbox server and Hub Transport servers. This monitor shows the average latency, in milliseconds, of RPC requests. The average is calculated over all RPCs since exrpc32 was loaded. The value should be less than 100 ms at all times.
	MessagesDeliveredPersec	Messages Delivered Per sec		Exchange responds to client requests and attempts to fulfill them as quickly and efficiently as possible. This monitor shows the rate that messages are delivered to all recipients. It indicates the current message delivery rate to the store.
	MessagesQueuedForSubmissionISMailbox	Messages Queued For Submission IS Mailbox		Mailbox servers depend on Hub Transport servers for message delivery. This monitor shows the current number of submitted messages that are not yet processed by the transport layer. This value should be below 50 at all times. A higher value for more than 15 minutes may indicate that there are connectivity issues to the transport servers or that backpressure is occurring.
	DirectoryAccessLDAPReadsPersec	Directory Access LDAP Reads Per sec		Exchange responds to client requests and attempts to fulfill them as quickly and efficiently as possible. This monitor shows the current rate that the Lightweight Directory Access Protocol (LDAP) reads occur while processing requests for the client.
	IODatabaseReadsAverageLatency	IO Database Reads Average Latency		Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the average length of time, in milliseconds, per database read operation.
	RPCClientBackoffPersec	RPC Client Backoff Per sec		Exchange throttles RPC clients to prevent individual clients from overusing server resources. This monitor shows the rate that the server notifies the client to back off. It indicates the rate at which client backoffs are occurring. Higher values may indicate that the server may be incurring a higher load resulting in an increase in overall averaged RPC latencies, causing client throttling to occur. This can also occur when certain client user actions are being performed. Depending on what the client is doing and the rate at which RPC operations are occurring, it may be normal to see backoffs occurring.
	RPCNumofSlowPackets	RPC Number of Slow Packets		When you use Microsoft Office Outlook in MAPI mode, Outlook executes client operations as RPCs between the client and the server. This monitor indicates the number of RPC packets in the past 1,024 packets that have latencies longer than 2 seconds. This value should be less than 1 on average, and should be less than 3 at all times.
	ClientRPCsFailedServerTooBusyPersec	Client RPCs Failed Server Too Busy Per sec		Exchange throttles RPC clients to prevent individual clients from overusing server resources. This monitor shows the client-reported rate of failed RPCs (since the store was started) due to the Server Too Busy ROC error. This value should be 0 at all times. Higher values may indicate RPC threads are exhausted or client throttling is occurring for clients running versions of Outlook earlier than Microsoft Office Outlook 2007.
	DirectoryAccessLDAPSearchesPersec	Directory Access LDAP Searches Per sec		Exchange responds to client requests and attempts to fulfill them as quickly and efficiently as possible. This monitor shows the current rate that the LDAP searches occur while processing requests for the client.
	LogRecordStallsPersec	Log Record Stalls Per sec		Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the number of log records that cannot be added to the log buffers per second because the log buffers are full. If this counter is non-zero most of the time, the log buffer size may be a bottleneck. If I/O log write latencies are high, check for RAID5 or sync replication on log devices. The average value should be below 10 per second. Spikes (maximum values) should not be higher than 100 per second.
	ReplicationReceiveQueueSize	Replication Receive Queue Size		This monitor shows the number of replication messages waiting to be processed. This value should be less than 100 at all times. This value should return to a minimum value between replication intervals.
	MessagesQueuedForSubmissionISPublic	Messages Queued For Submission IS Public		Mailbox servers depend on Hub Transport servers for message delivery. This monitor shows the current number of submitted messages that are not yet processed by the transport layer. This value should be below 20 at all times.
	UserCount	User Count		This monitor shows the number of users connected to the information store. It can be used to determine the current user load.
	DatabaseCacheSizeMB	Database Cache Size MB		Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the amount of system memory, in megabytes, used by the database cache manager to hold commonly used information from the database files to prevent file operations. If the database cache size seems too small for optimal performance and there is little available memory on the system (check the value of Memory/Available Bytes), adding more memory to the system may increase performance. If there is ample memory on the system and the database cache size is not growing beyond a certain point, the database cache size may be capped at an artificially low limit. Increasing this limit may increase performance.
	RPCRequestsoutstanding	RPC Requests outstanding		RPC Requests outstanding is the current number of outstanding RPC requests.
	RPCAveragedLatency	RPC Averaged Latency	Milliseconds	When you use Microsoft Office Outlook in MAPI mode, Outlook executes client operations as RPCs between the client and the server. This monitor indicates the RPC latency, in milliseconds, averaged for all operations in the last 1,024 packets. This value should not be higher than 25 ms on average. To determine if certain protocols are causing overall RPC latencies, monitor MSExchangeIS Client (*)RPC Average Latency to separate latencies based on client protocol. Cross-reference MSExchangeISRPC Client Backoff/sec to ensure higher latencies are not causing client throttling.
	RPCRequests	RPC Requests		RPC Operations/sec is the rate at which RPC operations occur.
	RPCOperationsPersec	RPC Operations Per sec		When you use Microsoft Office Outlook in MAPI mode, Outlook executes client operations as RPCs between the client and the server. This monitor indicates the current number of RPC operations that are occurring per second. Should closely correspond to historical baselines. Values much higher than expected indicate that the workload has changed, while values much lower than expected indicate a bottleneck preventing client requests from reaching the server.
	LogThreadsWaiting	Log Threads Waiting		Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the number of threads waiting for their data to be written to the log to complete an update of the database. If this number is too high, the log may be a bottleneck. This value should be less than 10 on average. Regular spikes concurrent with log record stall spikes indicate that the transaction log disks are a bottleneck. If the value for log threads waiting is more than the spindles available for the logs, there is a bottleneck on the log disks.
	DatabasePageFaultStallsPersec	Database Page Fault Stalls Per sec		Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the rate that database file page requests require of the database cache manager to allocate a new page from the database cache. This should be 0 at all times. If this value is non-zero, this indicates that the database is not able to flush dirty pages to the database file fast enough to make pages free for new page allocations.

Agent G2 - Microsoft Exchange 2007 - Server Role - Mailbox Servers replication (MBSR) DotNet v4

Description

Applicable on Exchange Servers with the MBSR role

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2007 - Server Role - Mailbox Servers replication DotNet v4	ReplayQueueLength	Replay Queue Length		This monitor indicates issues involving the replication engine and replication partners. These issues can be local or remote. This monitor shows the number of transaction log files waiting to be replayed into the passive copy. It indicates the current replay queue length. Higher values cause longer store mount times when a handoff, failover, or activation is performed.
	CopyQueueLength	Copy Queue Length		This monitor indicates issues involving the replication engine and replication partners. These issues can be local or remote. This monitor shows the number of transaction log files waiting to be copied to the passive copy log file folder. A copy is not considered complete until it has been checked for corruption. This value should be less than 10 at all times for Continuous Cluster Replication(CCR). It should be less than 1 at all times for local continuous replication (LCR).

Agent G2 - Microsoft Exchange 2010 DotNet v4 - Server Role - Unified Messaging Servers (UMS)

Description

Applicable on Exchange Servers with the UMS role

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2007 - Server Role - Unified Messaging servers DotNet v4	OperationsoverSixSeconds	OperationsoverSixSeconds	NULL	Shows the number of all Unified Messaging operations that took more than six seconds to complete. This is the time during which a caller was waiting for Unified Messaging to respond.
	MailboxServerAccessFailures	MailboxServerAccessFailures	NULL	Shows the number of times the system did not access a Mailbox server. This value should be 0 at all times. A non-zero value indicates that Unified Messaging is having problems with MAPI connectivity to mbx servers.
	CallsDisconnectedbyCallersDuringUMAudioHourglass	CallsDisconnectedbyCallersDuringUMAudioHourglass	NULL	Shows the number of calls during which the caller disconnected while Unified Messaging was playing the audio hourglass tones. This value should be 0 at all times. A non-zero value suggests excessive latency between a Unified Messaging server and targeted domain controller.

Agent G2 - Microsoft Exchange 2007 General DotNet v4

Description

Monitors Microsoft Exchange 2007 General Performance Counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2007 General DotNet v4	ConnectionAttemptsPersec	Connection Attempts Per Second		The rate, in seconds, at which connections to the WWW service have been attempted since the service started.
	NumberBytesinallHeaps	Number Bytes in all Heaps		Shows the sum of four other counters: Gen 0 Heap Size, Gen 1 Heap Size, Gen 2 Heap Size, and the Large Object Heap Size. This counter indicates the current memory allocated in bytes on the GC Heaps.
	NumberofExcepsThrownPersec	Number of Exceptions Thrown Per Second		Displays the number of exceptions thrown per second. These include both .NET exceptions and unmanaged exceptions that get converted into .NET exceptions.
	PercentTimeinGC	Percent Time in GC	%	% Time in GC is the percentage of elapsed time that was spent in performing a garbage collection (GC) since the last GC cycle. This counter is usually an indicator of the work done by the Garbage Collector on behalf of the application to collect and compact memory. This counter is updated only at the end of every GC and the counter value reflects the last observed value; its not an average.

Agent G2 - Microsoft Exchange 2010 AD Access DC DotNet v4

Description

Monitor Microsoft Exchange 2010 AD Access DC performance counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2010 AD Access DC DotNet v4	LDAPReadTime	LDAP Read Time		Shows the time (in ms) to send an LDAP read request and receive a response.
Agent G2 - Microsoft Exchange 2010 AD Access DC DotNet v4	LDAPSearchTime	LDAP Search Time	Milliseconds	Shows the time (in ms) to send an LDAP search request and receive a response. Should be below 50 ms on average. Spikes (maximum values) shouldn't be higher than 100 ms.

Agent G2 - Microsoft Exchange 2010 DotNet v4

Description

Monitor Microsoft Exchange 2010 performance counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2010 DotNet v4	ReceiveQueueSizeMailBox	Receive Queue Size Mailbox		Maximum allowed number of messages in the mailbox receive queue.
	LDAPSearchesTimedOut	LDAP Searches Timed Out		LDAP Searches timed out per minute is the number of LDAP searches returned LDAP_TIMEOUT during the last minute.
	RPCAveragedLatency	RPC Averaged Latency	Milliseconds	When you use Microsoft Office Outlook in MAPI mode, Outlook executes client operations as RPCs between the client and the server. This monitor indicates the RPC latency, in milliseconds, averaged for all operations in the last 1,024 packets. This value should not be higher than 25 ms on average. To determine if certain protocols are causing overall RPC latencies, monitor MSExchangeIS Client (*)RPC Average Latency to separate latencies based on client protocol. Cross-reference MSExchangeISRPC Client Backoff/sec to ensure higher latencies are not causing client throttling.
	ActiveNonSmtpDeliveryQueueLength	Active Non-SMTP Delivery Queue Length		The number of messages queued for delivery to a Non-SMTP transport. The value format is a 4-byte integer.
	MessagesQueuedForSubmissionMailBox	Messages Queued For Submission Mailbox		Messages Queued For Submission is the current number of submitted messages which are not yet processed by transport.
	PollingDelay	Polling Delay	Seconds	Polling delay is the latency between when the most recent Mapi Event was polled and when the event was created in seconds.
	LDAPSearchTime	LDAP Search Time	Milliseconds	Shows the time (in ms) to send an LDAP search request and receive a response. Should be below 50 ms on average. Spikes (maximum values) shouldn't be higher than 100 ms.
	ClientLogonsMailBox	Client Logons Mailbox		The number of client logons (including system processes). The average number of logons per client depends on the type and version of the client.
	MessagesSentPersecMailBox	Messages Sent Persec Mailbox		Messages Sent/sec is the rate that messages are sent to the transport.
	Versionbucketsallocated	Version Buckets Allocated		It provides the total number of version buckets allocated.
	SubmissionQueueLength	Submission Queue Length		The number of items in the submission queue when sample was taken.
	AverageDeliveryTimePublicFolder	Average Delivery Time Public Folder	Milliseconds	Average Delivery Time is the average time in milliseconds between the submission of a message to the public store and the delivery to all local recipients (recipients on the same server) for the last 10 messages.
	UnreachableQueueLength	Unreachable Queue Length		The number of messages in Unreachable Queue when sample was taken.
	MessagesDeliveredPersecMailBox	Messages Delivered Persec Mailbox		Messages Delivered/sec is the rate that messages are delivered to all recipients.
	AverageDeliveryTimeMailBox	Average Delivery Time Mailbox	Milliseconds	Average Delivery Time is the average time in milliseconds between the submission of a message to the mailbox store and the delivery to all local recipients (recipients on the same server) for the last 10 messages.
	RPCRequests	RPC Requests		RPC Operations/sec is the rate at which RPC operations occur.
	MessagesDeliveredPersecPublicFolder	Messages Delivered Persec Public Folder		Messages Delivered Persec Public Folder
	ClientLogonsPublicFolder	Client Logons Public Folder		Client Logons is the number of clients (including system processes) currently logged on.
	RetryRemoteDeliveryQueueLength	Retry Remote Delivery Queue Length		Retry Remote Delivery Queue Length is the number of messages in retry in the remote delivery queues.
	LogGenerationCheckpointDepth	Log Generation Checkpoint Depth		Log Generation Checkpoint Depth represents the amount of work, in count of log files, that will need to be redone or undone to the database file(s) if the process crashes.
	LargestDeliveryQueueLength	Largest Delivery Queue Length		The number of items in the largest delivery queue.
	IODatabaseReadsPersec	I/O Database Reads Persec		I/O Database Reads/sec is the rate of database read operations completed.
	ActiveMailboxDeliveryQueueLength	Active Mailbox Delivery Queue Length		The number of messages queued for delivery to an active mailbox. The value format is a 4-byte integer.
	SendQueueSizeMailbox	Send Queue Size Mailbox		Indicates the number of messages in the mailbox store's send queue.
	PercentageofFailedEventDispatchers	Percentage of Failed Event Dispatchers	%	It is the percentage of Event Dispatchers that are in failure mode.
	PoisonQueueLength	Poison Queue Length		The number of messages in the poison message queue.
	LogBytesWritePersec	Log Bytes Write Persec	Bytes per second	Log Bytes Write per second is the rate bytes are written to the log.
	RetryMailboxDeliveryQueueLength	Retry Mailbox Delivery Queue Length		Measures the number of messages currently in the retry mailbox delivery queue. Messages in this queue are in a retry state because an issue prevented their delivery. If the issue is transient, a subsequent attempt to send the message may be successful. A queue length < 200 can be considered as OK.
	SendQueueSizePublicFolder	Send Queue Size Public Folder		Number of messages in a public folders send queue. The value should be less than 500.
	RetryNonSmtpDeliveryQueueLength	Retry Non-SMTP Delivery Queue Length		Assures the number of messages currently in the retry non-SMTP delivery queue. Messages in this queue are in a retry state because an issue prevented their delivery. If the issue is transient, a subsequent reattempt to send the message may be successful. A queue length < 200 can be considered as Ok.
	ReceiveQueueSizePublicFolder	Receive Queue Size Public Folder		Indicates the number of public folder replication messages waiting to be processed.
	MessagesSentPersecPublicFolder	Messages Sent Persec Public Folder		Messages Sent/sec is the rate that messages are sent to the transport.
	MessagesQueuedForSubmissionPublicFolder	Messages Queued For Submission Public Folder		Messages Queued For Submission is the current number of submitted messages which are not yet processed by transport.
	MessageRecipientsDeliveredPersecMailBox	Message Recipients Delivered Persec Mailbox		Shows the rate at which messages are delivered to all recipients. Indicates current message delivery rate to the store.
	AggregateDeliveryQueueLengthAllQueues	Aggregate Delivery Queue Length All Queues		The number of messages queued for aggregate delivery.
	ActiveRemoteDeliveryQueueLength	Active Remote Delivery Queue Length		The number of messages queued for remote delivery.
	ClientRPCsSucceded	Client RPCs Succeeded		The client-reported total number of successful RPCs (since the store was started).
	ClientLatency10secRPC	Client Latency 10 sec RPC	Milliseconds	The client-reported number of successful RPCs with latencies > 10 seconds.
	ActiveClientLogonsPublicFolder	Active Client Logons Public Folder		Active Client Logons is the number of clients that performed any action within the last ten minute time interval.
	IODatabaseWritesPersec	I/O Database Writes Persec		I/O Database Writes/sec is the rate of database write operations completed.
	ActiveClientLogonsMailBox	Active Client Logons Mailbox		The number of logons that have been active within the last ten minute time interval.
	MessageRecipientsDeliveredPersecPublicFolder	Message Recipients Delivered Persec Public Folder		Message Recipients Delivered/sec is the rate that recipients receive messages.
	LongRunningLDAPOperations	Long Running LDAP Operations		Shows the number of LDAP operations on this domain controller that took longer than the specified threshold per minute. (Default threshold is 15 seconds.). Should be less than 50 at all times.

Agent G2 - Microsoft Exchange 2010 DotNet v4 - Server Role - Client Access Servers (CAS)

Description

Applicable on Exchange Servers with the Client Access servers (CAS) role

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2010 DotNet v4 - Server Role - Client Access Servers	DownloadTasksCompleted	Download Tasks Completed	NULL	Download Tasks Completed is the number of OAB download tasks completed
	ActiveSyncRequestsPersec	ActiveSync Requests Per Second	NULL	Shows the number of HTTP requests that are received from the client via ASP.NET per second
	AverageSearchTime	Average Search Time	NULL	Average Search Time is the average time that elapsed while waiting for a search to complete
	CurrentConnections	Current Connections	NULL	The number of active connections to the WWW service.
	DownloadTaskQueued	Download Task Queued	NULL	Download Task Queued is one(1) if task is queued for execution, otherwise zero(0)
	SyncCommandsPersec	Sync Commands Per Second	NULL	Sync Commands/sec is the number of Sync commands that are processed per second. Clients use this command to synchronize items within a folder
	AvailabilityRequestssec	Availability Requests Per Second	NULL	Availability Requests per second is the number of requests serviced per second. The request can be only for free busy or include suggestions. One request may contain multiple mailboxes
	OWARequestsPersec	OWA Requests Per Second	NULL	Requests/sec is the number of requests handled by Outlook Web App per second
	AverageTimetoProcessaFreeBusyRequest	Average Time to Process a Free Busy Request	NULL	Average Time to Process a Free Busy Request is the average time to process a free busy request in seconds. One request may contain multiple mailboxes. Free busy responses do not have meeting suggestions
	AverageResponseTime	Average Response Time	NULL	Average Response Time is the average time (in milliseconds) that elapsed between the beginning and end of an OEH or ASPX request

Agent G2 - Microsoft Exchange 2010 DotNet v4 - Server Role - Client Access Servers ASPNET (CAS ASPNET)

Description

Applicable on Exchange Servers with the Client Access servers ASPNET (CAS) role

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2010 DotNet v4 - Server Role - Client Access Servers ASPNET	ApplicationRestarts	Application Restarts	NULL	Number of times the application has been restarted during the web server lifetime
	RequestWaitTime	Request Wait Time	NULL	RPC Requests outstanding is the current number of outstanding RPC requests.
	RequestsInApplicationQueue	Requests In Application Queue	NULL	The current number of requests, including those that are queued, currently executing, or waiting to be written to the client. Under the ASP.NET process model, when this counter exceeds the requestQueueLimit defined in the processModel configuration section, ASP.NET will begin rejecting requests.
	WorkerProcessRestarts	Worker Process Restarts	NULL	Number of times a worker process has restarted on the machine.
	RequestsCurrent	Requests Current	NULL	The current number of requests both executing and queued

Agent G2 - Microsoft Exchange 2010 DotNet v4 - Server Role - Edge Transport Server (ETS)

Description

Applicable on Exchange Servers with the Edge Transport servers (ETS) role

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2010 DotNet v4 - Server Role - Edge Transport Server	LargestDeliveryQueueLength	Largest Delivery Queue Length	NULL	The number of items in the largest delivery queue.
	IODatabaseReadsPersec	I/O Database Reads Per Second	NULL	I/O Database Reads/sec is the rate of database read operations completed.
	UnreachableQueueLength	Unreachable Queue Length	NULL	The number of messages in Unreachable Queue when sample was taken.
	SubmissionQueueLength	Submission Queue Length	NULL	The number of items in the submission queue when sample was taken.
	IODatabaseWritesPersec	I/O Database Writes Per Second	NULL	I/O Database Writes/sec is the rate of database write operations completed.
	LogThreadsWaiting	Log Threads Waiting	NULL	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the number of threads waiting for their data to be written to the log to complete an update of the database. If this number is too high, the log may be a bottleneck. This value should be less than 10 on average. Regular spikes concurrent with log record stall spikes indicate that the transaction log disks are a bottleneck. If the value for log threads waiting is more than the spindles available for the logs, there is a bottleneck on the log disks.
	DatabaseCachePercentHit	Database Cache Percent Hit	%	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the percentage of database file page requests that were fulfilled by the database cache without causing a file operation. If this percentage is too low, the database cache size may be too small. This value should be over 90% for companies with majority online mode clients. It should be over 99% for companies with majority cached mode clients. If the hit ratio is less than these numbers, the database cache may be insufficient.
	LogRecordStallsPersec	Log Record Stalls Per Second	NULL	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the number of log records that cannot be added to the log buffers per second because the log buffers are full. If this counter is non-zero most of the time, the log buffer size may be a bottleneck. If I/O log write latencies are high, check for RAID5 or sync replication on log devices. The average value should be below 10 per second. Spikes (maximum values) should not be higher than 100 per second.
	ActiveRemoteDeliveryQueueLength	Active Remote Delivery Queue Length	NULL	The number of messages queued for remote delivery.
	Versionbucketsallocated	Version Buckets Allocated	NULL	It provides the total number of version buckets allocated.
	AggregateDeliveryQueueLengthAllQueues	Aggregate Delivery Queue Length All Queues	NULL	The number of messages queued for aggregate delivery.
	RetryRemoteDeliveryQueueLength	Retry Remote Delivery Queue Length	NULL	Retry Remote Delivery Queue Length is the number of messages in retry in the remote delivery queues.
	PoisonQueueLength	Poison Queue Length	NULL	The number of messages in the poison message queue.

Agent G2 - Microsoft Exchange 2010 DotNet v4 - Server Role - HUB Transport Servers (HTS)

Description

Applicable on Exchange Servers with the HUB Transport servers (HTS) role

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2010 DotNet v4 - Server Role - HUB Transport Servers	IODatabaseReadsPersec	I/O Database Reads Per Second	NULL	I/O Database Reads/sec is the rate of database read operations completed.
	MessagesSubmittedPerSecond	Messages Submitted Per Second	NULL	This monitor is useful in assessing the efficiency and efficacy of the current design. They also provide insight into the interaction between different transport components, including the information store interface. It shows the number of messages that have been queued in the Submission queue per second.
	SubmissionQueueLength	Submission Queue Length	NULL	The number of items in the submission queue when sample was taken.
	UnreachableQueueLength	Unreachable Queue Length	NULL	The number of messages in Unreachable Queue when sample was taken.
	ActiveMailboxDeliveryQueueLength	Active Mailbox Delivery Queue Length	NULL	The number of messages queued for delivery to an active mailbox. The value format is a 4-byte integer.
	LogThreadsWaiting	Log Threads Waiting	NULL	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the number of threads waiting for their data to be written to the log to complete an update of the database. If this number is too high, the log may be a bottleneck. This value should be less than 10 on average. Regular spikes concurrent with log record stall spikes indicate that the transaction log disks are a bottleneck. If the value for log threads waiting is more than the spindles available for the logs, there is a bottleneck on the log disks.
	MessagesCompletedDeliveryPerSecond	Messages Completed Delivery Per Second	NULL	This monitor is useful in assessing the efficiency and efficacy of the current design. They also provide insight into the interaction between different transport components, including the information store interface. It shows the number of messages that are delivered per second.
	AggregateDeliveryQueueLengthAllQueues	Aggregate Delivery Queue Length All Queues	NULL	The number of messages queued for aggregate delivery.
	RetryMailboxDeliveryQueueLength	Retry Mailbox Delivery Queue Length	NULL	Measures the number of messages currently in the retry mailbox delivery queue. Messages in this queue are in a retry state because an issue prevented their delivery. If the issue is transient, a subsequent attempt to send the message may be successful. A queue length < 200 can be considered as OK.
	RetryNonSmtpDeliveryQueueLength	Retry Non-SMTP Delivery Queue Length	NULL	Assures the number of messages currently in the retry non-SMTP delivery queue. Messages in this queue are in a retry state because an issue prevented their delivery. If the issue is transient, a subsequent reattempt to send the message may be successful. A queue length < 200 can be considered as Ok.
	Versionbucketsallocated	Version Buckets Allocated	NULL	It provides the total number of version buckets allocated.
	ActiveNonSmtpDeliveryQueueLength	Active Non-SMTP Delivery Queue Length	NULL	The number of messages queued for delivery to a Non-SMTP transport. The value format is a 4-byte integer.
	IODatabaseWritesPersec	I/O Database Writes Per Second	NULL	I/O Database Writes/sec is the rate of database write operations completed.
	PoisonQueueLength	Poison Queue Length	NULL	The number of messages in the poison message queue.
	MessagesQueuedforDeliveryPerSecond	Messages Queued for Delivery Per Second	NULL	This monitor is useful in assessing the efficiency and efficacy of the current design. They also provide insight into the interaction between different transport components, including the information store interface. It shows the number of messages that have been queued for delivery per second.
	LargestDeliveryQueueLength	Largest Delivery Queue Length	NULL	The number of items in the largest delivery queue.
	ActiveRemoteDeliveryQueueLength	Active Remote Delivery Queue Length	NULL	The number of messages queued for remote delivery.
	LogRecordStallsPersec	Log Record Stalls Per Second	NULL	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the number of log records that cannot be added to the log buffers per second because the log buffers are full. If this counter is non-zero most of the time, the log buffer size may be a bottleneck. If I/O log write latencies are high, check for RAID5 or sync replication on log devices. The average value should be below 10 per second. Spikes (maximum values) should not be higher than 100 per second.

Agent G2 - Microsoft Exchange 2010 DotNet v4 - Server Role - Mailbox Servers (MBS)

Description

Applicable on Exchange Servers with the Mailbox Servers (MBS) role

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2010 DotNet v4 - Server Role - Mailbox Servers	RPCLatencyaveragemsec	RPC Latency Average (ms)	NULL	Exchange communicates with Hub Transport servers via RPC. This counter is useful in isolating and determining issues involving the interface between the Microsoft Exchange Information Store service on the Mailbox server and Hub Transport servers. This monitor shows the average latency, in milliseconds, of RPC requests. The average is calculated over all RPCs since exrpc32 was loaded. The value should be less than 100 ms at all times.
	UserCount	User Count	NULL	This monitor shows the number of users connected to the information store. It can be used to determine current user load.
	ReplicationReceiveQueueSize	Replication Receive Queue Size	NULL	This monitor shows the number of replication messages waiting to be processed. This value should be less than 100 at all times. This value should return to a minimum value between replication intervals.
	LogThreadsWaiting	Log Threads Waiting	NULL	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the number of threads waiting for their data to be written to the log to complete an update of the database. If this number is too high, the log may be a bottleneck. This value should be less than 10 on average. Regular spikes concurrent with log record stall spikes indicate that the transaction log disks are a bottleneck. If the value for log threads waiting is more than the spindles available for the logs, there is a bottleneck on the log disks.
	RPCAveragedLatency	RPC Averaged Latency	Milliseconds	When you use Microsoft Office Outlook in MAPI mode, Outlook executes client operations as RPCs between the client and the server. This monitor indicates the RPC latency, in milliseconds, averaged for all operations in the last 1,024 packets. This value should not be higher than 25 ms on average. To determine if certain protocols are causing overall RPC latencies, monitor MSExchangeIS Client (*)RPC Average Latency to separate latencies based on client protocol. Cross-reference MSExchangeISRPC Client Backoff/sec to ensure higher latencies are not causing client throttling.
	RPCRequestsoutstanding	RPC Requests Outstanding	NULL	RPC Requests outstanding is the current number of outstanding RPC requests
	MessagesQueuedForSubmissionISMailbox	Messages Queued For Submission (IS Mailbox)	NULL	Mailbox servers depend on Hub Transport servers for message delivery. This monitor shows the current number of submitted messages that are not yet processed by the transport layer. This value should be below 50 at all times. A higher value for more than 15 minutes may indicate that there are connectivity issues to the transport servers or that backpressure is occurring.
	RPCNumofSlowPackets	RPC Number of Slow Packets	NULL	When you use Microsoft Office Outlook in MAPI mode, Outlook executes client operations as RPCs between the client and the server. This monitor indicates the number of RPC packets in the past 1,024 packets that have latencies longer than 2 seconds. This value should be less than 1 on average, and should be less than 3 at all times.
	RPCRequests	RPC Requests	NULL	RPC Operations/sec is the rate at which RPC operations occur.
	DatabaseCacheSizeMB	Database Cache Size (MB)	NULL	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the amount of system memory, in megabytes, used by the database cache manager to hold commonly used information from the database files to prevent file operations. If the database cache size seems too small for optimal performance and there is little available memory on the system (check the value of Memory/Available Bytes), adding more memory to the system may increase performance. If there is ample memory on the system and the database cache size is not growing beyond a certain point, the database cache size may be capped at an artificially low limit. Increasing this limit may increase performance.
	DirectoryAccessLDAPSearchesPersec	Directory Access LDAP Searches Persec	NULL	Exchange responds to client requests and attempts to fulfill them as quickly and efficiently as possible. This monitor shows the current rate that the LDAP searches occur while processing requests for the client.
	RPCOperationsPersec	RPC Operations Persec	NULL	When you use Microsoft Office Outlook in MAPI mode, Outlook executes client operations as RPCs between the client and the server. This monitor indicates the current number of RPC operations that are occurring per second. Should closely correspond to historical baselines. Values much higher than expected indicate that the workload has changed, while values much lower than expected indicate a bottleneck preventing client requests from reaching the server.
	RPCClientBackoffPersec	RPC Client Backoff Persec	NULL	Exchange throttles RPC clients to prevent individual clients from overusing server resources. This monitor shows the rate that the server notifies the client to back off. It indicates the rate at which client backoffs are occurring. Higher values may indicate that the server may be incurring a higher load resulting in an increase in overall averaged RPC latencies, causing client throttling to occur. This can also occur when certain client user actions are being performed. Depending on what the client is doing and the rate at which RPC operations are occurring, it may be normal to see backoffs occurring.
	LogRecordStallsPersec	Log Record Stalls Persec	NULL	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the number of log records that cannot be added to the log buffers per second because the log buffers are full. If this counter is non-zero most of the time, the log buffer size may be a bottleneck. If I/O log write latencies are high, check for RAID5 or sync replication on log devices. The average value should be below 10 per second. Spikes (maximum values) should not be higher than 100 per second.
	DatabasePageFaultStallsPersec	Database Page Fault Stalls Persec	NULL	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the rate that database file page requests require of the database cache manager to allocate a new page from the database cache. This should be 0 at all times. If this value is non-zero, this indicates that the database is not able to flush dirty pages to the database file fast enough to make pages free for new page allocations.
	DatabaseCachePercentHit	Database Cache Percent Hit	%	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the percentage of database file page requests that were fulfilled by the database cache without causing a file operation. If this percentage is too low, the database cache size may be too small. This value should be over 90% for companies with majority online mode clients. It should be over 99% for companies with majority cached mode clients. If the hit ratio is less than these numbers, the database cache may be insufficient.
	MessagesDeliveredPersec	Messages Delivered Persec	NULL	Exchange responds to client requests and attempts to fulfill them as quickly and efficiently as possible. This monitor shows the rate that messages are delivered to all recipients. It indicates current message delivery rate to the store.
	IODatabaseReadsAverageLatency	IO Database Reads Average Latency	NULL	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the average length of time, in milliseconds, per database read operation.
	MessagesQueuedForSubmissionISPublic	Messages Queued For Submission (IS Public)	NULL	Mailbox servers depend on Hub Transport servers for message delivery. This monitor shows the current number of submitted messages that are not yet processed by the transport layer. This value should be below 20 at all times.
	DirectoryAccessLDAPReadsPersec	Directory Access LDAP Reads Persec	NULL	Exchange responds to client requests and attempts to fulfill them as quickly and efficiently as possible. This monitor shows the current rate that the Lightweight Directory Access Protocol (LDAP) reads occur while processing requests for the client.
	ClientRPCsFailedServerTooBusyPersec	Client RPCs Failed Server Too Busy Persec	NULL	Exchange throttles RPC clients to prevent individual clients from overusing server resources. This monitor shows the client-reported rate of failed RPCs (since the store was started) due to the Server Too Busy ROC error. This value should be 0 at all times. Higher values may indicate RPC threads are exhausted or client throttling is occurring for clients running versions of Outlook earlier than Microsoft Office Outlook 2007.
	IODatabaseWritesAverageLatency	IO Database Writes Average Latency	NULL	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the average length of time, in milliseconds, per database write operation.

Agent G2 - Microsoft Exchange 2010 DotNet v4 - Server Role - Mailbox Servers Replication (MBSR)

Description

Applicable on Exchange Servers with the Mailbox Servers Replication (MBSR) role

Prerequisites

NULL

Supported Metric

Agent G2 - Microsoft Exchange 2010 General DotNet v4

Description

Monitor Microsoft Exchange 2010 General performance counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2010 DotNet v4 - Server Role - Mailbox Servers Replication	ReplayQueueLength	Replay Queue Length	NULL	This monitor indicate issues involving the replication engine and replication partners. These issues can be local or remote. This monitor shows the number of transaction log files waiting to be replayed into the passive copy. It indicates the current replay queue length. Higher values cause longer store mount times when a handoff, failover, or activation is performed.
	CopyQueueLength	Copy Queue Length	NULL	This monitor indicate issues involving the replication engine and replication partners. These issues can be local or remote. This monitor shows the number of transaction log files waiting to be copied to the passive copy log file folder. A copy is not considered complete until it has been checked for corruption. This value should be less than 10 at all times for Continuous Cluster Replication(CCR). It should be less than 1 at all times for local continuous replication (LCR).
	CallsDisconnectedbyCallersDuringUMAudioHourglass	Calls Disconnected by Callers During UM Audio Hourglass	NULL	Shows the number of calls during which the caller disconnected while Unified Messaging was playing the audio hourglass tones. This value should be 0 at all times. A non-zero value suggests excessive latency between a Unified Messaging server and targeted domain controller.
	OperationsoverSixSeconds	Operations over Six Seconds	NULL	Shows the number of all Unified Messaging operations that took more than six seconds to complete. This is the time during which a caller was waiting for Unified Messaging to respond.
	MailboxServerAccessFailures	Mailbox Server Access Failures	NULL	Shows the number of times the system did not access a Mailbox server. This value should be 0 at all times. A non-zero value indicates that Unified Messaging is having problems with MAPI connectivity to mbx servers.

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2010 General DotNet v4	NumberofExcepsThrownPersec	NumberofExcepsThrownPersec	NULL	Displays the number of exceptions thrown per second. These include both .NET exceptions and unmanaged exceptions that get converted into .NET exceptions.
	NumberBytesinallHeaps	NumberBytesinallHeaps	NULL	Shows the sum of four other counters: Gen 0 Heap Size, Gen 1 Heap Size, Gen 2 Heap Size, and the Large Object Heap Size. This counter indicates the current memory allocated in bytes on the GC Heaps.
	ConnectionAttemptsPersec	ConnectionAttemptsPersec	NULL	The rate, in seconds, at which connections to the WWW service have been attempted since the service started.
	PercentTimeinGC	PercentTimeinGC	%	% Time in GC is the percentage of elapsed time that was spent in performing a garbage collection (GC) since the last GC cycle. This counter is usually an indicator of the work done by the Garbage Collector on behalf of the application to collect and compact memory. This counter is updated only at the end of every GC and the counter value reflects the last observed value; its not an average.

Agent G2 - Microsoft Exchange 2013 AD Access DC DotNet v4

Description

Monitor Microsoft Exchange 2013 AD Access DC performance counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2013 AD Access DC DotNet v4	ADAccessDomainControllersLDAPReadTime	LDAPReadTime	NULL	LDAP Read Time for a given DC is the time (in milliseconds) taken to send an LDAP read request to the specified DC and receive a response.
Agent G2 - Microsoft Exchange 2013 AD Access DC DotNet v4	ADAccessDomainControllersLDAPSearchTime	LDAPSearchTime	NULL	LDAP Search Time is the time (in milliseconds) taken to send an LDAP search request and receive a response.

Agent G2 - Microsoft Exchange 2013 DotNet v4 - Server Role - Client Access Servers (CAS)

Description

Applicable on Exchange Servers with the Client Access Servers (CAS) role

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2013 DotNet v4 - Server Role - Client Access Servers	OWARequestsPersec	OWA Requests Per Second	NULL	Requests/sec is the number of requests handled by Outlook Web App per second
	ActiveSyncRequestsPersec	ActiveSync Requests Per Second	NULL	Shows the number of HTTP requests that are received from the client via ASP.NET per second
	AvailabilityRequestssec	Availability Requests Per Second	NULL	Availability Requests per second is the number of requests serviced per second. The request can be only for free busy or include suggestions. One request may contain multiple mailboxes
	SyncCommandsPersec	Sync Commands Per Second	NULL	Sync Commands/sec is the number of Sync commands that are processed per second. Clients use this command to synchronize items within a folder
	CurrentConnections	Current Connections	NULL	The number of active connections to the WWW service.
	AverageResponseTime	Average Response Time	NULL	Average Response Time is the average time (in milliseconds) that elapsed between the beginning and end of an OEH or ASPX request
	AverageSearchTime	Average Search Time	NULL	Average Search Time is the average time that elapsed while waiting for a search to complete
	AverageTimetoProcessaFreeBusyRequest	Average Time to Process a Free Busy Request	NULL	Average Time to Process a Free Busy Request is the average time to process a free busy request in seconds. One request may contain multiple mailboxes. Free busy responses do not have meeting suggestions

Agent G2 - Microsoft Exchange 2013 DotNet v4 - Server Role - Client Access Servers ASPNET (CAS ASPNET)

Description

Applicable on Exchange Servers with the Client Access Servers ASPNET (CAS ASPNET) role

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2013 DotNet v4 - Server Role - Client Access Servers ASPNET	RequestsInApplicationQueue	Requests In Application Queue	NULL	The current number of requests, including those that are queued, currently executing, or waiting to be written to the client. Under the ASP.NET process model, when this counter exceeds the requestQueueLimit defined in the processModel configuration section, ASP.NET will begin rejecting requests.
	ApplicationRestarts	Application Restarts	NULL	Number of times the application has been restarted during the web server lifetime
	RequestWaitTime	Request Wait Time	NULL	RPC Requests outstanding is the current number of outstanding RPC requests.
	RequestsCurrent	Requests Current	NULL	The current number of requests both executing and queued
	WorkerProcessRestarts	Worker Process Restarts	NULL	Number of times a worker process has restarted on the machine.

Agent G2 - Microsoft Exchange 2013 DotNet v4 - Server Role - Edge Transport Server (ETS)

Description

Applicable on Exchange Servers with the Edge Transport Servers (ETS) role

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2013 DotNet v4 - Server Role - Edge Transport Server	LogRecordStallsPersec	Log Record Stalls Per Second	NULL	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the number of log records that cannot be added to the log buffers per second because the log buffers are full. If this counter is non-zero most of the time, the log buffer size may be a bottleneck. If I/O log write latencies are high, check for RAID5 or sync replication on log devices. The average value should be below 10 per second. Spikes (maximum values) should not be higher than 100 per second.
	DatabaseCachePercentHit	Database Cache Percent Hit	%	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the percentage of database file page requests that were fulfilled by the database cache without causing a file operation. If this percentage is too low, the database cache size may be too small. This value should be over 90% for companies with majority online mode clients. It should be over 99% for companies with majority cached mode clients. If the hit ratio is less than these numbers, the database cache may be insufficient.
	Versionbucketsallocated	Version Buckets Allocated	NULL	It provides the total number of version buckets allocated.
	UnreachableQueueLength	Unreachable Queue Length	NULL	The number of messages in Unreachable Queue when sample was taken.
	PoisonQueueLength	Poison Queue Length	NULL	The number of messages in the poison message queue.
	LogThreadsWaiting	Log Threads Waiting	NULL	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the number of threads waiting for their data to be written to the log to complete an update of the database. If this number is too high, the log may be a bottleneck. This value should be less than 10 on average. Regular spikes concurrent with log record stall spikes indicate that the transaction log disks are a bottleneck. If the value for log threads waiting is more than the spindles available for the logs, there is a bottleneck on the log disks.
	SubmissionQueueLength	Submission Queue Length	NULL	The number of items in the submission queue when sample was taken.
	IODatabaseWritesPersec	I/O Database Writes Per Second	NULL	I/O Database Writes/sec is the rate of database write operations completed.
	IODatabaseReadsPersec	I/O Database Reads Per Second	NULL	I/O Database Reads/sec is the rate of database read operations completed.

Agent G2 - Microsoft Exchange 2013 DotNet v4 - Server Role - HUB Transport Servers (HTS)

Description

Applicable on Exchange Servers with the HUB Transport Servers (HTS) role

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2013 DotNet v4 - Server Role - HUB Transport Servers	IODatabaseWritesPersec	I/O Database Writes Per Second	NULL	I/O Database Writes/sec is the rate of database write operations completed.
	MessagesQueuedforDeliveryPerSecond	Messages Queued for Delivery Per Second	NULL	This monitor is useful in assessing the efficiency and efficacy of the current design. They also provide insight into the interaction between different transport components, including the information store interface. It shows the number of messages that have been queued for delivery per second.
	SubmissionQueueLength	Submission Queue Length	NULL	The number of items in the submission queue when sample was taken.
	ActiveNonSmtpDeliveryQueueLength	Active Non-SMTP Delivery Queue Length	NULL	The number of messages queued for delivery to a Non-SMTP transport. The value format is a 4-byte integer.
	MessagesSubmittedPerSecond	Messages Submitted Per Second	NULL	This monitor is useful in assessing the efficiency and efficacy of the current design. They also provide insight into the interaction between different transport components, including the information store interface. It shows the number of messages that have been queued in the Submission queue per second.
	IODatabaseReadsPersec	I/O Database Reads Per Second	NULL	I/O Database Reads/sec is the rate of database read operations completed.
	RetryMailboxDeliveryQueueLength	Retry Mailbox Delivery Queue Length	NULL	Measures the number of messages currently in the retry mailbox delivery queue. Messages in this queue are in a retry state because an issue prevented their delivery. If the issue is transient, a subsequent attempt to send the message may be successful. A queue length < 200 can be considered as OK.
	UnreachableQueueLength	Unreachable Queue Length	NULL	The number of messages in Unreachable Queue when sample was taken.
	MessagesCompletedDeliveryPerSecond	Messages Completed Delivery Per Second	NULL	This monitor is useful in assessing the efficiency and efficacy of the current design. They also provide insight into the interaction between different transport components, including the information store interface. It shows the number of messages that are delivered per second.
	LogRecordStallsPersec	Log Record Stalls Per Second	NULL	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the number of log records that cannot be added to the log buffers per second because the log buffers are full. If this counter is non-zero most of the time, the log buffer size may be a bottleneck. If I/O log write latencies are high, check for RAID5 or sync replication on log devices. The average value should be below 10 per second. Spikes (maximum values) should not be higher than 100 per second.
	PoisonQueueLength	Poison Queue Length	NULL	The number of messages in the poison message queue.
	ActiveMailboxDeliveryQueueLength	Active Mailbox Delivery Queue Length	NULL	The number of messages queued for delivery to an active mailbox. The value format is a 4-byte integer.
	RetryNonSmtpDeliveryQueueLength	Retry Non-SMTP Delivery Queue Length	NULL	Assures the number of messages currently in the retry non-SMTP delivery queue. Messages in this queue are in a retry state because an issue prevented their delivery. If the issue is transient, a subsequent reattempt to send the message may be successful. A queue length < 200 can be considered as Ok.
	Versionbucketsallocated	Version Buckets Allocated	NULL	It provides the total number of version buckets allocated.
	LogThreadsWaiting	Log Threads Waiting	NULL	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the number of threads waiting for their data to be written to the log to complete an update of the database. If this number is too high, the log may be a bottleneck. This value should be less than 10 on average. Regular spikes concurrent with log record stall spikes indicate that the transaction log disks are a bottleneck. If the value for log threads waiting is more than the spindles available for the logs, there is a bottleneck on the log disks.

Agent G2 - Microsoft Exchange 2013 DotNet v4 - Server Role - Mailbox Servers (MBS)

Description

Applicable on Exchange Servers with the Mailbox Servers (MBS) role

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2013 DotNet v4 - Server Role - Mailbox Servers	RPCRequests	RPC Requests	NULL	RPC Operations/sec is the rate at which RPC operations occur.
	DatabaseCacheSizeMB	Database Cache Size (MB)	NULL	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the amount of system memory, in megabytes, used by the database cache manager to hold commonly used information from the database files to prevent file operations. If the database cache size seems too small for optimal performance and there is little available memory on the system (check the value of Memory/Available Bytes), adding more memory to the system may increase performance. If there is ample memory on the system and the database cache size is not growing beyond a certain point, the database cache size may be capped at an artificially low limit. Increasing this limit may increase performance.
	LogThreadsWaiting	Log Threads Waiting	NULL	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the number of threads waiting for their data to be written to the log to complete an update of the database. If this number is too high, the log may be a bottleneck. This value should be less than 10 on average. Regular spikes concurrent with log record stall spikes indicate that the transaction log disks are a bottleneck. If the value for log threads waiting is more than the spindles available for the logs, there is a bottleneck on the log disks.
	RPCAveragedLatency	RPC Averaged Latency	Milliseconds	When you use Microsoft Office Outlook in MAPI mode, Outlook executes client operations as RPCs between the client and the server. This monitor indicates the RPC latency, in milliseconds, averaged for all operations in the last 1,024 packets. This value should not be higher than 25 ms on average. To determine if certain protocols are causing overall RPC latencies, monitor MSExchangeIS Client (*)RPC Average Latency to separate latencies based on client protocol. Cross-reference MSExchangeISRPC Client Backoff/sec to ensure higher latencies are not causing client throttling.
	DatabasePageFaultStallsPersec	Database Page Fault Stalls Per Second	NULL	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the rate that database file page requests require of the database cache manager to allocate a new page from the database cache. This should be 0 at all times. If this value is non-zero, this indicates that the database is not able to flush dirty pages to the database file fast enough to make pages free for new page allocations.
	RPCOperationsPersec	RPC Operations Per Second	NULL	When you use Microsoft Office Outlook in MAPI mode, Outlook executes client operations as RPCs between the client and the server. This monitor indicates the current number of RPC operations that are occurring per second. Should closely correspond to historical baselines. Values much higher than expected indicate that the workload has changed, while values much lower than expected indicate a bottleneck preventing client requests from reaching the server.
	RPCLatencyaveragemsec	RPC Latency Average (ms)	NULL	Exchange communicates with Hub Transport servers via RPC. This counter is useful in isolating and determining issues involving the interface between the Microsoft Exchange Information Store service on the Mailbox server and Hub Transport servers. This monitor shows the average latency, in milliseconds, of RPC requests. The average is calculated over all RPCs since exrpc32 was loaded. The value should be less than 100 ms at all times.
	LogRecordStallsPersec	Log Record Stalls Per Second	NULL	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the number of log records that cannot be added to the log buffers per second because the log buffers are full. If this counter is non-zero most of the time, the log buffer size may be a bottleneck. If I/O log write latencies are high, check for RAID5 or sync replication on log devices. The average value should be below 10 per second. Spikes (maximum values) should not be higher than 100 per second.
	IODatabaseReadsAverageLatency	I/O Database Reads Average Latency	NULL	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the average length of time, in milliseconds, per database read operation.
	RPCRequestsoutstanding	RPC Requests Outstanding	NULL	RPC Requests outstanding is the current number of outstanding RPC requests.
	IODatabaseWritesAverageLatency	I/O Database Writes Average Latency	NULL	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the average length of time, in milliseconds, per database write operation.
	DatabaseCachePercentHit	Database Cache Percent Hit	%	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the percentage of database file page requests that were fulfilled by the database cache without causing a file operation. If this percentage is too low, the database cache size may be too small. This value should be over 90% for companies with majority online mode clients. It should be over 99% for companies with majority cached mode clients. If the hit ratio is less than these numbers, the database cache may be insufficient.
	DirectoryAccessLDAPSearchesPersec	Directory Access LDAP Searches Per Second	NULL	Exchange responds to client requests and attempts to fulfill them as quickly and efficiently as possible. This monitor shows the current rate that the LDAP searches occur while processing requests for the client.

Agent G2 - Microsoft Exchange 2013 DotNet v4 - Server Role - Mailbox Servers Replication (MBSR)

Description

Applicable on Exchange Servers with the Mailbox Servers replication (MBSR) role

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2013 DotNet v4 - Server Role - Mailbox Servers Replication	ReplayQueueLength	ReplayQueueLength	NULL	This monitor indicate issues involving the replication engine and replication partners. These issues can be local or remote. This monitor shows the number of transaction log files waiting to be replayed into the passive copy. It indicates the current replay queue length. Higher values cause longer store mount times when a handoff, failover, or activation is performed.
	CopyQueueLength	CopyQueueLength	NULL	This monitor indicate issues involving the replication engine and replication partners. These issues can be local or remote. This monitor shows the number of transaction log files waiting to be copied to the passive copy log file folder. A copy is not considered complete until it has been checked for corruption. This value should be less than 10 at all times for Continuous Cluster Replication(CCR). It should be less than 1 at all times for local continuous replication (LCR).

Agent G2 - Microsoft Exchange 2013 DotNet v4 - Server Role - Unified Messaging Servers (UMS)

Description

Applicable on Exchange Servers with the Unified Messaging servers ( UMS) role

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2013 DotNet v4 - Server Role - Unified Messaging Servers	CallsDisconnectedbyCallersDuringUMAudioHourglass	CallsDisconnectedbyCallersDuringUMAudioHourglass	NULL	Shows the number of calls during which the caller disconnected while Unified Messaging was playing the audio hourglass tones. This value should be 0 at all times. A non-zero value suggests excessive latency between a Unified Messaging server and targeted domain controller.
	OperationsoverSixSeconds	OperationsoverSixSeconds	NULL	Shows the number of all Unified Messaging operations that took more than six seconds to complete. This is the time during which a caller was waiting for Unified Messaging to respond.

Agent G2 - Microsoft Exchange 2013 General DotNet v4

Description

Microsoft Exchange 2013 General DotNet v4

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2013 General DotNet v4	NumberofExcepsThrownPersec	Number of Exceptions Thrown Per Second	NULL	Displays the number of exceptions thrown per second. These include both .NET exceptions and unmanaged exceptions that get converted into .NET exceptions.
	NumberBytesinallHeaps	Number of Bytes in all Heaps	NULL	Shows the sum of four other counters: Gen 0 Heap Size, Gen 1 Heap Size, Gen 2 Heap Size, and the Large Object Heap Size. This counter indicates the current memory allocated in bytes on the GC Heaps.
	ConnectionAttemptsPersec	Connection Attempts Per Second	NULL	The rate, in seconds, at which connections to the WWW service have been attempted since the service started.
	PercentTimeinGC	Percent Time in GC	%	% Time in GC is the percentage of elapsed time that was spent in performing a garbage collection (GC) since the last GC cycle. This counter is usually an indicator of the work done by the Garbage Collector on behalf of the application to collect and compact memory. This counter is updated only at the end of every GC and the counter value reflects the last observed value; it's not an average.

Agent G2 - Microsoft Exchange 2016 DotNet v4 - AD Access DC Performance Counters

Description

Monitor Microsoft Exchange 2016 AD Access DC performance counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2016 DotNet v4 - AD Access DC Performance Counters	msmsexchange2016.adaccess.domaincontrollers.ldap.readtime	MSExchange2016 ADAccessDomainControllersLDAPReadTime	NULL	LDAP Read Time for a given DC is the time (in milliseconds) taken to send an LDAP read request to the specified DC and receive a response.
	msexchange2016.adaccess.domaincontrollers.ldap.searchtime	MSExchange2016 ADAccessDomainControllersLDAPSearchTime	NULL	LDAP Search Time is the time (in milliseconds) taken to send an LDAP search request and receive a response.
	msexchange2016.adaccess.processes.ldap.readtime	MSExchange2016 ADAccessProcessesLDAPReadTime	NULL	LDAP Read Time is the time (in milliseconds) taken to send an LDAP read request and receive a response.
	msexchange2016.adaccess.processes.ldap.searchtime	MSExchange2016 ADAccessProcessesLDAPSearchTime	NULL	LDAP Search Time is the time (in milliseconds) taken to send an LDAP search request and receive a response.

Agent G2 - Microsoft Exchange 2016 DotNet v4 - Client Access Servers

Description

Monitors MSExchange 2016 CAS performance data using WMI Classes

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2016 DotNet v4 - Client Access Servers	msexchange2016.owa.requests.per.sec	MSExchange2016 OWARequestsPersec	NULL	Requests/sec is the number of requests handled by Outlook Web App per second.
	msexchange2016.active.sync.requests.per.sec	MSExchange2016 ActiveSyncRequestsPersec	NULL	Requests/sec is the number of HTTP requests that are received from the client via ASP.NET per second.
	msexchange2016.current.connections	MSExchange2016 CurrentConnections	NULL	Current Connections is the current number of connections established with the Web service.
	msexchange2016.availability.requests.sec	MSExchange2016 AvailabilityRequestssec	NULL	Availability Requests per second is the number of requests serviced per second. The request can be only for free busy or include suggestions. One request may contain multiple mailboxes.
	msexchange2016.average.search.time	MSExchange2016 AverageSearchTime	NULL	Average Search Time is the average time that elapsed while waiting for a search to complete.
	msexchange2016.average.response.time	MSExchange2016 AverageResponseTime	NULL	Average Response Time is the average time (in milliseconds) that elapsed between the beginning and end of an OEH or ASPX request.
	msexchange2016.sync.commands.per.sec	MSExchange2016 SyncCommandsPersec	NULL	Sync Commands/sec is the number of Sync commands that are processed per second. Clients use this command to synchronize items within a folder.
	msexchange2016.average.time.to.process.a.free.busy.request	MSExchange2016 AverageTimetoProcessaFreeBusyRequest	NULL	Average Time to Process a Free Busy Request is the average time to process a free busy request in seconds. One request may contain multiple mailboxes. Free busy responses do not have meeting suggestions.

Agent G2 - Microsoft Exchange 2016 DotNet v4 - Client Access Servers ASPNET

Description

Monitors MSExchange 2016 CAS ASPNET performance data using WMI classes

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2016 DotNet v4 - Client Access Servers ASPNET	msexchange2016.application.restarts	MSExchange2016 ApplicationRestarts	NULL	Number of times the application has been restarted during the web server's lifetime.
	msexchange2016.requests.in.application.queue	MSExchange2016 RequestsInApplicationQueue	NULL	The current number of requests, including those that are queued, currently executing, or waiting to be written to the client. Under the ASP.NET process model, when this counter exceeds the requestQueueLimit defined in the processModel configuration section, ASP.NET will begin rejecting requests.
	msexchange2016.requests.current	MSExchange2016 RequestsCurrent	NULL	The current number of requests, including those that are queued, currently executing, or waiting to be written to the client. Under the ASP.NET process model, when this counter exceeds the requestQueueLimit defined in the processModel configuration section, ASP.NET will begin rejecting requests.
	msexchange2016.worker.process.restarts	MSExchange2016 WorkerProcessRestarts	NULL	Number of times a worker process has restarted on the machine.
	msexchange2016.request.wait.time	MSExchange2016 RequestWaitTime	NULL	The number of milliseconds the most recent request was waiting in the queue.

Agent G2 - Microsoft Exchange 2016 DotNet v4 - General Performance Counters

Description

Monitors MSExchange 2016 general performance data using WMI classes

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2016 DotNet v4 - General Performance Counters	msexchange2016.connection.attempts.per.sec	MSExchange2016 ConnectionAttemptsPersec	NULL	The rate, in seconds, at which connections to the WWW service have been attempted since the service started.

Agent G2 - Microsoft Exchange 2016 DotNet v4 - HUB Transport Servers (HTS)

Description

Monitors MSExchange 2016 HTS performance data using WMI classes

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2016 DotNet v4 - HUB Transport Servers	msexchange2016.poison.queue.length	MSExchange2016 PoisonQueueLength	NULL	The number of messages in the poison message queue.
	msexchange2016.active.non.smtp.delivery.queue.length	MSExchange2016 ActiveNonSmtpDeliveryQueueLength	NULL	The number of messages queued for delivery to a Non-SMTP transport. The value format is a 4-byte integer.
	msexchange2016.retry.mailbox.delivery.queue.length	MSExchange2016 RetryMailboxDeliveryQueueLength	NULL	Measures the number of messages currently in the retry mailbox delivery queue. Messages in this queue are in a retry state because an issue prevented their delivery. If the issue is transient, a subsequent attempt to send the message may be successful. A queue length < 200 can be considered as OK.
	msexchange2016.messages.completed.delivery.per.second	MSExchange2016 MessagesCompletedDeliveryPerSecond	NULL	This monitor is useful in assessing the efficiency and efficacy of the current design. They also provide insight into the interaction between different transport components, including the information store interface. It shows the number of messages that are delivered per second.
	msexchange2016.retry.non.smtp.delivery.queue.length	MSExchange2016 RetryNonSmtpDeliveryQueueLength	NULL	Assures the number of messages currently in the retry non-SMTP delivery queue. Messages in this queue are in a retry state because an issue prevented their delivery. If the issue is transient, a subsequent reattempt to send the message may be successful. A queue length < 200 can be considered as Ok.
	msexchange2016.messages.queued.for.delivery.per.second	MSExchange2016 MessagesQueuedforDeliveryPerSecond	NULL	This monitor is useful in assessing the efficiency and efficacy of the current design. They also provide insight into the interaction between different transport components, including the information store interface. It shows the number of messages that have been queued for delivery per second.
	msexchange2016.active.mailbox.delivery.queue.length	MSExchange2016 ActiveMailboxDeliveryQueueLength	NULL	The number of messages queued for delivery to an active mailbox. The value format is a 4-byte integer.
	msexchange2016.submission.queue.length	MSExchange2016 SubmissionQueueLength	NULL	The number of items in the submission queue when sample was taken.
	msexchange2016.messages.submitted.per.second	MSExchange2016 MessagesSubmittedPerSecond	NULL	This monitor is useful in assessing the efficiency and efficacy of the current design. They also provide insight into the interaction between different transport components, including the information store interface. It shows the number of messages that have been queued in the Submission queue per second.
	msexchange2016.unreachable.queue.length	MSExchange2016 UnreachableQueueLength	NULL	The number of messages in Unreachable Queue when sample was taken.

Agent G2 - Microsoft Exchange 2016 DotNet v4 - Mailbox Servers (MBS)

Description

Monitors MSExchange MBS performance data using WMI classes

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2016 DotNet v4 - Mailbox Servers	msexchange2016.directory.access.ldap.searches.per.sec	MSExchange2016 DirectoryAccessLDAPSearchesPersec	NULL	Exchange responds to client requests and attempts to fulfill them as quickly and efficiently as possible. This monitor shows the current rate that the LDAP searches occur while processing requests for the client.
	msexchange2016.rpc.latency.average.msec	MSExchange2016 RPCLatencyaveragemsec	NULL	RPC Latency average (msec) is the average latency in milliseconds of RPC requests. Average is calculated over all RPCs since exrpc32 was loaded.
	msexchange2016.rpc.operations.per.sec	MSExchange2016 RPCOperationsPersec	NULL	When you use Microsoft Office Outlook in MAPI mode, Outlook executes client operations as RPCs between the client and the server. This monitor indicates the current number of RPC operations that are occurring per second. Should closely correspond to historical baselines. Values much higher than expected indicate that the workload has changed, while values much lower than expected indicate a bottleneck preventing client requests from reaching the server.
	msexchange2016.rpc.averaged.latency	MSExchange2016 RPCAveragedLatency	NULL	When you use Microsoft Office Outlook in MAPI mode, Outlook executes client operations as RPCs between the client and the server. This monitor indicates the RPC latency, in milliseconds, averaged for all operations in the last 1,024 packets. This value should not be higher than 25 ms on average. To determine if certain protocols are causing overall RPC latencies, monitor MSExchangeIS Client (*)RPC Average Latency to separate latencies based on client protocol. Cross-reference MSExchangeISRPC Client Backoff/sec to ensure higher latencies are not causing client throttling.
	msexchange2016.rpc.requests	MSExchange2016 RPCRequests	NULL	RPC Operations/sec is the rate at which RPC operations occur.
	msexchange2016.rpc.requests.outstanding	MSExchange2016 RPCRequestsoutstanding	NULL	RPC Requests outstanding is the current number of outstanding RPC requests.

Agent G2 - Microsoft Exchange 2016 DotNet v4 - Mailbox Servers Replication (MBSR)

Description

Monitors MSExchange 2016 MBSR performance data using WMI classes

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2016 DotNet v4 - Mailbox Servers Replication	msexchange2016.replay.queue.length	MSExchange2016 ReplayQueueLength	NULL	This monitor indicate issues involving the replication engine and replication partners. These issues can be local or remote. This monitor shows the number of transaction log files waiting to be replayed into the passive copy. It indicates the current replay queue length. Higher values cause longer store mount times when a handoff, failover, or activation is performed.
	msexchange2016.copy.queue.length	MSExchange2016 CopyQueueLength	NULL	This monitor indicate issues involving the replication engine and replication partners. These issues can be local or remote. This monitor shows the number of transaction log files waiting to be copied to the passive copy log file folder. A copy is not considered complete until it has been checked for corruption. This value should be less than 10 at all times for Continuous Cluster Replication(CCR). It should be less than 1 at all times for local continuous replication (LCR).

Agent G2 - Microsoft Exchange 2016 DotNet v4 - Unified Messaging Servers (UMS)

Description

Monitors MSExchange UMS performance data using WMI classes

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2016 DotNet v4 - Unified Messaging Servers	msexchange2016.calls.disconnected.by.callers.during.um.audio.hour.glass	MSExchange2016 CallsDisconnectedbyCallersDuringUMAudioHourglass	NULL	Shows the number of calls during which the caller disconnected while Unified Messaging was playing the audio hourglass tones. This value should be 0 at all times. A non-zero value suggests excessive latency between a Unified Messaging server and targeted domain controller.
	msexchange2016.operations.over.six.seconds	MSExchange2016 OperationsoverSixSeconds	NULL	Shows the number of all Unified Messaging operations that took more than six seconds to complete. This is the time during which a caller was waiting for Unified Messaging to respond.

Agent G2 - Microsoft Exchange AD Access DC DotNet v4

Description

Monitor Microsoft Exchange AD Access DC performance counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange AD Access DC DotNet v4	LDAPSearchTime	LDAPSearchTime	Milliseconds	Shows the time (in ms) to send an LDAP search request and receive a response. Should be below 50 ms on average. Spikes (maximum values) shouldn't be higher than 100 ms.
Agent G2 - Microsoft Exchange AD Access DC DotNet v4	LDAPReadTime	LDAPReadTime	NULL	NULL

Agent G2 - Microsoft Exchange DAG DB Performance Counters - WMI DotNet v4

Description

This Templates provide metric details for Hub, Transport, Delivery failures and connections, SMTP messages sent per second.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange DAG DB Performance Counters - WMI DotNet v4	transportsmtpreceive.connectionscreatedpersec	MSExchange TransportSMTPReceive ConnectionsCreatedPerSecond	NULL	Number of new connections to the SMTP server that are established each second.
	replication.copyqueuelength	MSExchange ReplicationCopyQueueLength DAG	NULL	Number of transaction log files waiting to be copied to the passive copy log file folder. A copy isn't considered complete until it has been checked for corruption.
	transportsmtpreceive.messagebytesreceivedpersec	MSExchange TransportSMTPReceive MessageBytesReceivedPerSecond	NULL	Number of bytes received in messages per second.
	deliverysmtpsend.connectionfailures	MSExchange TransportSMTPSend ConnectionFailures	NULL	Number of connection failures encountered by the SMTPSend connector.
	proxyhubselector.hubselectionroutingfailures	MSExchange ProxyHubSelector HubSelectionRoutingFailures	NULL	Number of messages that failed to be routed.
	transportsmtpavailability.failuresduetomaximumlocalloopcount	MSExchange TransportSMPTAvailability FailuresDueToMaximumLocalLoopCount	NULL	Total number of message delivery failures due to reaching maximum local loop count.
	frontendtransportsmtpblindproxy.totalproxyuserlookupfailures	MSExchange FrontEndTransportSMTPBlindProxy TotalProxyUserLookupFailures	NULL	Total number of user lookup failures (during the sliding time window) while trying to set up a proxy session.
	deliverystoredriver.inboundlocaldeliverycallspersecond	MSExchange DeliveryStoreDriver InboundLocalDeliveryCallsPerSecond	NULL	Number of local delivery calls per second.
	transportsmtpavailability.percentfailuresduetobackpressure	MSExchange TransportSMPTAvailability PercentFailuresDueToBackPressure	%	Failure percentage of legitimate connections in the sliding window due to back pressure.
	replication.replayqueuelength	MSExchange ReplicationReplayQueueLength DAG	NULL	Number of transaction log files waiting to be replayed into the passive copy.
	frontendtransportproxyroutingagent.messagesfailedtoroute	MSExchange FrontEndTransportProxyRoutingAgent MessagesFailedToRoute	NULL	Total number of messages failed to be routed.
	transportsmtpsend.messagesbytessentpersec	MSExchange TransportSMTPSend MessageBytesSentPerSecond	NULL	Number of bytes sent per second.
	deliverystoredriver.inboundmessagedeliveryattemptspersecond	MSExchange DeliveryStoreDriver InboundMessageDeliveryAttemptsPerSecond	NULL	Number of attempts that are made per second to deliver a message.
	deliverysmtpsend.protocolerrors	MSExchange TransportSMTPSend Protocol Errors	NULL	Number of protocol errors encountered by the SMTPSend connector.
	frontendtransportsmtpblindproxy.totalproxyconnectionfailures	MSExchange FrontEndTransportSMTPBlindProxy TotalProxyConnectionFailures	NULL	Total number of connection failures (during the sliding time window) while trying to set up a proxy session.
	proxyhubselector.hubselectionorganizationmailboxfailures	MSExchange ProxyHubSelector HubSelectionOrganizationMailboxFailures	NULL	Number of messages that encountered organization mailbox lookup errors in Hub selection.
	ws.totalnumberofbytesproxied	MSExchange WS TotalBytesProxied	NULL	Total number of bytes proxied (after proxy session is set up.
	frontendtransportsmtpblindproxy.totalproxydnslookupfailures	MSExchange FrontEndTransportSMTPBlindProxy TotalProxyDNSLookupFailures	NULL	Total number of dns lookup failures (during the sliding time window) while trying to set up a proxy session.
	deliverysmtpavailability.percentfailuresduetomaxinboundconnectionlimit	MSExchange DeliverySMTPAvailability PercentFailuresDueToMaxInboundConnectionLimit	%	Failure percentage of legitimate connections in the sliding window due to MaxInboundConnectionLimit.
	frontendtransportsmtpblindproxy.percentageproxysetupfailures	MSExchange FrontEndTransportSMTPBlindProxy PercentageProxySetupFailures	%	Percentage of sessions (during the sliding time window) that could not be proxied due to failures.
	deliverystoredriver.inboundrecipientsdeliveredpersecond	MSExchange DeliveryStoreDriver InboundRecipientsDeliveredPerSecond	NULL	Number of recipients to whom the message was delivered per second.
	transportsmtpsend.dnserrors	MSExchange TransportSMTPSend DNSErrors	NULL	Number of DNS errors encountered by the SMTPSend connector.
	frontendtransportsmtpavailability.percentfailuresduetowliddown	MSExchange FrontEndTransportSMPTAvailability PercentFailuresDueToWLIDDown	%	Failure percentage of legitimate connections in the sliding window due to WLID down.
	proxyhubselector.hubselectionresolverfailures	MSExchange ProxyHubSelector HubSelectionResolverFailures	NULL	Number of messages that encountered recipient AD lookup errors in Hub selection.

Agent G2 - Microsoft Exchange Server 2003 DotNet v4

Description

Template for Exchange 2003 performance counters.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange Server 2003 DotNet v4	SendQueueSizePublicFolder	SendQueueSizePublicFolder	NULL	Number of messages in a public folders send queue. The value should be less than 500.
	WorkQueueLength	WorkQueueLength	NULL	The maximum number of recipients permitted in the MTA inbound and outbound queues for the information store, the Directory, and any connectors.
	TotalRecipientsQueued	TotalRecipientsQueued	NULL	Work Queue Length is the number of outstanding messages in the Work Queue, which indicates the number of messages not yet processed to completion by the MTA.
	WorkQueueBytes	WorkQueueBytes	NULL	WorkQueueBytes
	MessagesSentperminPublicFolder	MessagesSentperminPublicFolder	NULL	MessagesSentperminPublicFolder
	MessageRecipientsDeliveredperminMailbox	MessageRecipientsDeliveredperminMailbox	NULL	MessageRecipientsDeliveredperminMailbox
	MessagesSentperminMailbox	MessagesSentperminMailbox	NULL	MessagesSentperminMailbox
	MessagesDeliveredperminMailbox	MessagesDeliveredperminMailbox	NULL	MessagesDeliveredperminMailbox
	ClientLogonsPublicFolder	ClientLogonsPublicFolder	NULL	Client Logons is the number of clients (including system processes) currently logged on.
	SendQueueSizeMailbox	SendQueueSizeMailbox	NULL	Indicates the number of messages in the mailbox store's send queue.
	MessageRecipientsDeliveredperminPublicFolder	MessageRecipientsDeliveredperminPublicFolder	NULL	MessageRecipientsDeliveredperminPublicFolder
	ReceiveQueueSizeMailBox	ReceiveQueueSizeMailBox	NULL	Maximum allowed number of messages in the mailbox receive queue.
	ClientLogonsMailBox	ClientLogonsMailBox	NULL	The number of client logons (including system processes). The average number of logons per client depends on the type and version of the client.
	AverageDeliveryTimeMailBox	AverageDeliveryTimeMailBox	Milliseconds	Average Delivery Time is the average time in milliseconds between the submission of a message to the mailbox store and the delivery to all local recipients (recipients on the same server) for the last 10 messages.
	ReceiveQueueSizePublicFolder	ReceiveQueueSizePublicFolder	NULL	Indicates the number of public folder replication messages waiting to be processed.
	ActiveClientLogonsMailBox	ActiveClientLogonsMailBox	NULL	The number of logons that have been active within the last ten minute time interval.
	MessagesDeliveredperminPublicFolder	MessagesDeliveredperminPublicFolder	NULL	MessagesDeliveredperminPublicFolder
	AverageDeliveryTimePublicFolder	AverageDeliveryTimePublicFolder	Milliseconds	Average Delivery Time is the average time in milliseconds between the submission of a message to the public store and the delivery to all local recipients (recipients on the same server) for the last 10 messages.

Agent G2 - Microsoft Exchange Server 2007 DotNet v4

Description

Template for Exchange 2007 performance counters.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange Server 2007 DotNet v4	HubServersInRetryMailSub	HubServersInRetryMailSub	NULL	Hub Servers In Retry is the number of hub servers in retry.
	MessagesDeliveredPersecMailBox	MessagesDeliveredPersecMailBox	NULL	Messages Delivered/sec is the rate that messages are delivered to all recipients.
	AverageResponseTimeOWA	AverageResponseTimeOWA	NULL	Average Response Time is the average time (in milliseconds) that elapsed between the beginning and end of an OEH or ASPX request.
	LDAPSearchTime	LDAPSearchTime	Milliseconds	Shows the time (in ms) to send an LDAP search request and receive a response. Should be below 50 ms on average. Spikes (maximum values) shouldn't be higher than 100 ms.
	CopyQueueLengthRepl	CopyQueueLengthRepl	NULL	Copy Queue Length is the number of log generations waiting to be both copied and inspected successfully.
	RPCLatencyaveragemsecSI	RPCLatencyaveragemsecSI	NULL	RPC Latency average (msec) is the average latency in milliseconds of RPC requests. Average is calculated over all RPCs since exrpc32 was loaded.
	MessagesSentPersecMailBox	MessagesSentPersecMailBox	NULL	Messages Sent/sec is the rate that messages are sent to the transport.
	LDAPSearchesTimedOut	LDAPSearchesTimedOut	NULL	LDAP Searches timed out per minute is the number of LDAP searches returned LDAP_TIMEOUT during the last minute.
	RPCNumofSlowPackets	RPCNumofSlowPackets	NULL	When you use Microsoft Office Outlook in MAPI mode, Outlook executes client operations as RPCs between the client and the server. This monitor indicates the number of RPC packets in the past 1,024 packets that have latencies longer than 2 seconds. This value should be less than 1 on average, and should be less than 3 at all times.
	PollingDelay	PollingDelay	Seconds	Polling delay is the latency between when the most recent Mapi Event was polled and when the event was created in seconds.
	FailedSubmissionsPerSecondMailSub	FailedSubmissionsPerSecondMailSub	NULL	Failed Submissions Per Second
	ReceiveQueueSizeMailBox	ReceiveQueueSizeMailBox	NULL	Maximum allowed number of messages in the mailbox receive queue.
	ClientLatency10secRPCs	ClientLatency10secRPCs	Milliseconds	Shows a server RPC latency, in ms, averaged for the past 1,024 packets for a particular client protocol. Should be less than 50 ms on average for each client.
	Versionbucketsallocated	Versionbucketsallocated	NULL	It provides the total number of version buckets allocated.
	RPCRequests	RPCRequests	NULL	RPC Operations/sec is the rate at which RPC operations occur.
	MessageRecipientsDeliveredPersecMailBox	MessageRecipientsDeliveredPersecMailBox	NULL	Shows the rate at which messages are delivered to all recipients. Indicates current message delivery rate to the store.
	MessagesDeliveredPersecPublicFolder	MessagesDeliveredPersecPublicFolder	NULL	MessagesDeliveredPersecPublicFolder
	ReceiveQueueSizePublicFolder	ReceiveQueueSizePublicFolder	NULL	Indicates the number of public folder replication messages waiting to be processed.
	AverageSearchTimeOWA	AverageSearchTimeOWA	NULL	Average Search Time is the average time that elapsed while waiting for a search to complete.
	IODatabaseReadsPersec	IODatabaseReadsPersec	NULL	I/O Database Reads/sec is the rate of database read operations completed.
	SendQueueSizeMailbox	SendQueueSizeMailbox	NULL	Indicates the number of messages in the mailbox store's send queue.
	ActiveClientLogonsPublicFolder	ActiveClientLogonsPublicFolder	NULL	Active Client Logons is the number of clients that performed any action within the last ten minute time interval.
	AverageDeliveryTimePublicFolder	AverageDeliveryTimePublicFolder	Milliseconds	Average Delivery Time is the average time in miliseconds between the submission of a message to the public store and the delivery to all local recipients (recipients on the same server) for the last 10 messages.
	IODatabaseWritesPersec	IODatabaseWritesPersec	NULL	I/O Database Writes/sec is the rate of database write operations completed.
	ActiveClientLogonsMailBox	ActiveClientLogonsMailBox	NULL	The number of logons that have been active within the last ten minute time interval.
	RPCLatencyaveragemsec	RPCLatencyaveragemsec	NULL	Exchange communicates with Hub Transport servers via RPC. This counter is useful in isolating and determining issues involving the interface between the Microsoft Exchange Information Store service on the Mailbox server and Hub Transport servers. This monitor shows the average latency, in milliseconds, of RPC requests. The average is calculated over all RPCs since exrpc32 was loaded. The value should be less than 100 ms at all times.
	RPCAverageLatencyISClient	RPCAverageLatencyISClient	NULL	RPC Average Latency is a server RPC latency in milliseconds averaged for the past 1024 packets.
	LogGenerationCheckpointDepth	LogGenerationCheckpointDepth	NULL	Log Generation Checkpoint Depth represents the amount of work, in count of log files, that will need to be redone or undone to the database file(s) if the process crashes.
	AverageDeliveryTimeMailBox	AverageDeliveryTimeMailBox	Milliseconds	Average Delivery Time is the average time in miliseconds between the submission of a message to the mailbox store and the delivery to all local recipients (recipients on the same server) for the last 10 messages.
	ClientLogonsMailBox	ClientLogonsMailBox	NULL	The number of client logons (including system processes). The average number of logons per client depends on the type and version of the client.
	MessageRecipientsDeliveredPersecPublicFolder	MessageRecipientsDeliveredPersecPublicFolder	NULL	Message Recipients Delivered/sec is the rate that recipients receive messages.
	ReplayQueueLengthRepl	ReplayQueueLengthRepl	NULL	Replay Queue Length is the number of log generations waiting to be replayed.
	LogBytesWritePersec	LogBytesWritePersec	Bytes per second	Log Bytes Write per second is the rate bytes are written to the log.
	MessagesQueuedForSubmissionMailBox	MessagesQueuedForSubmissionMailBox	NULL	Messages Queued For Submission is the current number of submitted messages which are not yet processed by transport.
	AverageTimetoProcessaFreeBusyRequest	AverageTimetoProcessaFreeBusyRequest	NULL	Average Time to Process a Free Busy Request is the average time to process a free busy request in seconds. One request may contain multiple mailboxes. Free busy responses do not have meeting suggestions
	LongRunningLDAPOperations	LongRunningLDAPOperations	NULL	Shows the number of LDAP operations on this domain controller that took longer than the specified threshold per minute. (Default threshold is 15 seconds.). Should be less than 50 at all times.
	ClientLogonsPublicFolder	ClientLogonsPublicFolder	NULL	Client Logons is the number of clients (including system processes) currently logged on.
	MessagesQueuedForSubmissionPublicFolder	MessagesQueuedForSubmissionPublicFolder	NULL	Messages Queued For Submission is the current number of submitted messages which are not yet processed by transport.
	ClientRPCsSucceded	ClientRPCsSucceded	NULL	The client-reported total number of successful RPCs (since the store was started).
	PercentageofFailedEventDispatchers	PercentageofFailedEventDispatchers	%	It is the percentage of Event Dispatchers that are in failure mode.
	MessagesSentPersecPublicFolder	MessagesSentPersecPublicFolder	NULL	Messages Sent/sec is the rate that messages are sent to the transport.
	SendQueueSizePublicFolder	SendQueueSizePublicFolder	NULL	Number of messages in a public folders send queue. The value should be less than 500.

Agent G2 - Microsoft Hyper-V Memory Performance Counters DotNet v4

Description

Monitors HyperV Memory Performance Counters

Prerequisites

NULL

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Hyper-V Memory Performance Counters DotNet v4	Memory_HypervisorRootPartitionVirtualProcessors	Memory_HypervisorRootPartitionVirtualProcessors	NULL	The number of virtual processors that exist in the partition.
	Memory_HypervisorRootPartitionDepositedPages	Memory_HypervisorRootPartitionDepositedPages	NULL	This monitor returns the number of pages deposited into the partition. It shows how much memory the hypervisor is using for managing the system.
	Memory_HypervisorPartitionDepositedPages	Memory_HypervisorPartitionDepositedPages	NULL	For each partition, the hypervisor maintains a memory pool of RAM System physical address (SPA) pages. Pages can be deposited into or withdrawn from the pool. This monitor returns the number of pages deposited into the partition. It shows how much memory the hypervisor is using for managing the VM.
	Memory_availablebytes	Memory_availablebytes	NULL	The current amount of memory (in MB) that is available on the balancer node.
	Memory_RemotePhysicalPages	Memory_RemotePhysicalPages	NULL	The Virtual Interface Driver (VID) counters account for the guest address space and any additional memory the VID needs to manage the virtual machine. The number of physical pages that are not allocated from the preferred Non-Uniform Memory Access (NUMA) node. This counter lets you know on NUMA based systems if a VM is spanning multiple nodes.
	Memory_PhysicalPagesAllocated	Memory_PhysicalPagesAllocated	NULL	The Virtual Interface Driver (VID) counters account for the guest address space and any additional memory the VID needs to manage the virtual machine. This counter is the total number of guest pages and VID pages needed to manage the VM.
	Memory_averagepressure	Memory_averagepressure	NULL	The average pressure on the balancer node. This privides a view of the overall memory allocation of your system. A virtual machine with a pressure of 100 has exactly the amount of memory that it needs (this is equivalent to a memory availability of 0%). If the virtual machine pressure goes over 100,it now has less memory than it needs (equivalent to a negative memory availability) and if the virtual machine pressure is under 100 then the virtual machine has more memory than it needs. Ideally this value should be at 80 or lower. The closer this gets to 100, the closer you are to running out of memory. Once this number goes over 100 it indicates that there are virtual machines that are paging in the guest operating system.
	Memory_HypervisorRootPartitionValue2MGPApages	Memory_HypervisorRootPartitionValue2MGPApages	NULL	This monitor returns the number of 2M pages present in the Guest physical addresse GPA space of the partition. This counter indicates whether or not a VM is using large memory pages which improves overall VM performance.
	Memory_HypervisorPartitionValue2MGPApages	Memory_HypervisorPartitionValue2MGPApages	NULL	This monitor returns the number of 2M pages present in the Guest physical addresse GPA space of the partition. This counter indicates whether or not a VM is using large memory pages which improves overall VM performance.
	Memory_PagesPerSecond	Memory_PagesPerSecond	NULL	This performance monitor counter measures the rate at which pages are read from or written to disk to resolve hard page faults. To resolve hard page faults, the operating system must swap the contents of memory to disk, which negatively impacts performance. A high number of pages per second in correlation with low available physical memory may indicate a lack of physical memory. A value lesser than 500 is considered healthy.
	Memory_HypervisorPartitionVirtualProcessors	Memory_HypervisorPartitionVirtualProcessors	NULL	This monitor returns the number of virtual processors presented in the partition and configured to use by the VM.

Agent G2 - Microsoft Hyper-V Network Performance Counters DotNet v4

Description

Monitors BytesPersec, BytesDropped, BytesSentPersec, BytesReceivedPersec

Prerequisites

NULL

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Hyper-V Network Performance Counters DotNet v4	Network_LegacyNetworkAdapterBytesDropped	Network_LegacyNetworkAdapterBytesDropped	NULL	The Hyper-V Legacy Network Adapter counters represents the ethernet controller of the virtual machine. The number of bytes that are dropped on the network adapter.
	Network_LegacyNetworkAdapterBytesSentPerSec	Network_LegacyNetworkAdapterBytesSentPerSec	NULL	The Hyper-V Legacy Network Adapter counters represents the ethernet controller of the virtual machine. The number of bytes that are sent per second on the network adapter.
	Network_VirtualNetworkAdapterBytesPerSec	Network_VirtualNetworkAdapterBytesPerSec	NULL	The total number of bytes that traversed the network adapter per second.
	Network_VirtualSwitchBytesPersec	Network_VirtualSwitchBytesPersec	NULL	The Hyper-V Virtual Switch counters represents the statistics for the Hyper-V virtual switch. This counter represents the total number of bytes per second traversing the virtual switch.
	Network_LegacyNetworkAdapterBytesReceivedPerSec	Network_LegacyNetworkAdapterBytesReceivedPerSec	NULL	The Hyper-V Legacy Network Adapter counters represents the ethernet controller of the virtual machine. The number of bytes that are received per second on the network adapter.

Agent G2 - Microsoft Hyper-V OverallHealth Performance Counters DotNet v4

Description

Monitors VMHealthSummary, Hypervisor_NumberOfLogicalProcessors, Hypervisor_NumberOfVirtualMachines, Hypervisor_NumberOfVirtualProcessors, Hypervisor_TotalPages

Prerequisites

NULL

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Hyper-V OverallHealth Performance Counters DotNet v4	VMHealthSummary	VMHealthSummary	NULL	Health Critical - The number of virtual machines that display the state as critical. If Critical it means some resource (most likely disk) has been exhausted or other unrecoverable error has occurred. Health OK- The number of virtual machines that display the state as OK.
	Hypervisor_TotalPages	Hypervisor_TotalPages	NULL	This monitor returns the number of bootstrap and deposited pages in the hypervisor. The Hypervisor needs memory in order to keep track of Virtual Processors, Guest Virtual address to System Physical Address translation entries in the virtual TLB, and so on. The total pages keep track of the total amount of memory the Hypervisor is using for management or partitions. A page is 4 KBytes.
	Hypervisor_NumberOfLogicalProcessors	Hypervisor_NumberOfLogicalProcessors	NULL	The number of Logical Processors the system recognizes. The logical processors (LP) are important because they are where all the work is done. They are a representation of the physical processor.
	Hypervisor_NumberOfVirtualMachines	Hypervisor_NumberOfVirtualMachines	NULL	This monitor returns the number of virtual machines, or partitions, present in the system. Each virtual machine on the system is run in a container called a partition. If you have no VMs running, this value will be set to 1 because the host OS, called the root in Hyper-V, is also running in a partition. So if you have 2 guest VMs running this value will be 3. +1 for each guest and +1 for the root.
	Hypervisor_NumberOfVirtualProcessors	Hypervisor_NumberOfVirtualProcessors	NULL	The virtual processors (VPs) provides details about the guests and also if the system is overloaded.

Agent G2 - Microsoft Hyper-V Storage Performance Counters DotNet v4

Description

Monitors Storage_VirtualIDEControllerReadBytesPerSec, Storage_VirtualIDEControllerWriteBytesPerSec, Storage_VirtualStorageDeviceReadBytesPerSec, Storage_VirtualStorageDeviceWriteBytesPerSec, Storage_FlushCount, Storage_ErrorCount

Prerequisites

NULL

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Hyper-V Storage Performance Counters DotNet v4	Storage_VirtualStorageDeviceWriteBytesPerSec	Storage_VirtualStorageDeviceWriteBytesPerSec	NULL	Hyper-V provides two virtual storage buses for virtual machines. One is IDE and the other is SCSI. The Hyper-V virtual storage device gives details for virtual storage read and write. The total number of write operations that occurred on the virtual storage device since the virtual machine was started.
	Storage_ErrorCount	Storage_ErrorCount	NULL	The number of errors that occurred on the virtual storage device. The Error count should always be zero for the virtual storage device.
	Storage_FlushCount	Storage_FlushCount	NULL	The number of flush operations that occurred on the virtual storage device.
	Storage_VirtualIDEControllerWriteBytesPerSec	Storage_VirtualIDEControllerWriteBytesPerSec	NULL	Hyper-V provides two virtual storage buses for virtual machines. One is IDE and the other is SCSI. The Hyper-V virtual IDE controller gives details on disk rates and commands. The number of bytes written per second to the disks that are attached to the IDE controller.
	Storage_VirtualIDEControllerReadBytesPerSec	Storage_VirtualIDEControllerReadBytesPerSec	NULL	Hyper-V provides two virtual storage buses for virtual machines. One is IDE and the other is SCSI. The Hyper-V virtual IDE controller gives details on disk rates and commands. The number of bytes read per second from the disks that are attached to the Integrated Drive Electronics (IDE) controller.
	Storage_VirtualStorageDeviceReadBytesPerSec	Storage_VirtualStorageDeviceReadBytesPerSec	NULL	Hyper-V provides two virtual storage buses for virtual machines. One is IDE and the other is SCSI. The Hyper-V virtual storage device gives details for virtual storage read and write. The total number of bytes that are currently read per second on the virtual storage device.

Agent G2 - Microsoft IIS DotNet v4 - Performance Counters Extended

Description

Monitors Microsoft IIS Performance Counters using WMI classes

Prerequisites

NULL

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft IIS DotNet v4 - Performance Counters Extended	webservicecache.output.cache.current.hits.percent	WebServiceCache Output Cache Current Hits Percent	NULL	Output Cache current hit ratio. Calculated as (H)/(H+M) where H and M represent Hits and Misses in previous sample interval respectively.
	webservicecache.current.file.cache.memory.usage	WebServiceCache Current File Cache Memory Usage	NULL	Current number of bytes used for the user-mode file cache.
	webservicecache.metadata.cache.hits.percent	WebServiceCache Metadata Cache Hits Percent	NULL	The ratio of user-mode metadata cache hits to total cache requests (since service startup).
	webservicecache.kernel.uri.cache.hits.percent	WebServiceCache Kernel URI Cache Hits Percent	NULL	The ratio of kernel URI cache hits to total cache requests (since service startup).
	webservicecache.output.cache.current.memory.usage	WebServiceCache Output Cache Current Memory Usage	NULL	Current memory usage by output cache.
	webservicecache.file.cache.hits.percent	WebServiceCache File Cache Hits Percent	NULL	The ratio of user-mode file cache hits to total cache requests (since service startup).
	web.service.total.method.requests.per.sec	WebService Total Method Requests Per sec	NULL	Shows the rate HTTP requests are received.

Agent G2 - Microsoft IIS Monitoring - v2

Description

Monitors IIS counters

Prerequisites

Requires Agent version 14.0.0 or later.

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft IIS Custom Monitor	microsoft.iis.webservicecache.output.cache.current.memory.usage	Microsoft IIS WebServiceCache Output Cache Current Memory Usage	null	Current memory usage by output cache.
	microsoft.iis.webservicecache.current.file.cache.memory.usage	Microsoft IIS WebServiceCache Current File Cache Memory Usage	Bytes	Current number of bytes used for the user-mode file cache.
	microsoft.iis.notfounderrorspersec	Microsoft IIS Not Found Errors Per Sec	null	The rate of errors due to requests that couldn't be satisfied by the server because the requested document could not be found. These are generally reported as an HTTP 404 error code to the client.
	microsoft.iis.currentconnections	Microsoft IIS Current Connections	count	Current Connections is the current number of connections established with the Web service.
	microsoft.iis.totallockederrors	Microsoft IIS Total Locked Errors	count	Total Locked Errors is the number of requests that couldn't be satisfied by the server because the requested was locked (since service startup). These are generally reported as an HTTP 423 error code to the client
	microsoft.iis.webservicecache.metadata.cache.hits.percent	Microsoft IIS WebServiceCache Metadata Cache Hits Percent	null	The ratio of user-mode metadata cache hits to total cache requests (since service startup).
	microsoft.iis.requestwaittime.aspnet	Microsoft IIS Request Wait Time ASPNET	ms	The number of milliseconds the most recent request was waiting in the queue.
	microsoft.iis.logonattemptspersec	Microsoft IIS Logon Attempts Per Sec	null	The rate that logons to the Web service are being attempted.
	microsoft.iis.requestsnotfound.asp	Microsoft IIS Requests Not Found ASP	count	The number of requests for files that were no found.
	microsoft.iis.requestwaittime.asp	Microsoft IIS Request Wait Time ASP	ms	The number of milliseconds the most recent request was waiting in the queue.
	microsoft.iis.webservice.total.method.requests.per.sec	Microsoft IIS Total Method Requests Per Sec	null	Rate at which all HTTP requests are made per second.
	microsoft.iis.webservicecache.kernel.uri.cache.hits.percent	Microsoft IIS WebServiceCache Kernel URI Cache Hits Percent	null	The ratio of kernel URI cache hits to total cache requests (since service startup).
	microsoft.iis.application.pool.state	Microsoft IIS Application Pool State	null	The current status of the application pool (1 - Uninitialized, 2 - Initialized, 3 - Running, 4 - Disabling, 5 - Disabled, 6 - Shutdown Pending, 7 - Delete Pending)
	microsoft.iis.requestsqueued.aspnet	Microsoft IIS Requests Queued ASPNET	count	The number of requests waiting to be processed.
	microsoft.iis.totalnotfounderrors	Microsoft IIS Total Not Found Errors	count	Total Not Found Errors is the number of requests that couldn't be satisfied by the server because the requested document could not be found (since service startup). These are generally reported as an HTTP 404 error code to the client.
	microsoft.iis.totalconnectionattemptsallinstances	Microsoft IIS Total Connection Attempts all Instances	count	Total Connection Attempts is the number of connections that have been attempted using the Web service (since service startup). This counter is for all instances listed.
	microsoft.iis.lockederrorspersec	Microsoft IIS Locked Errors Per Sec	null	The rate of errors due to requests that couldn't be satisfied by the server because the requested document was locked. These are generally reported as an HTTP 423 error code to the client.
	microsoft.iis.connectionattemptspersec	Microsoft IIS Connection Attempts Per Sec	null	The rate that connections to the Web service are being attempted.
	microsoft.iis.webservicecache.output.cache.current.hits.percent	Microsoft IIS WebServiceCache Output Cache Current Hits Percent	null	Output Cache current hit ratio. Calculated as (H)/(H+M) where H and M represent Hits and Misses in previous sample interval respectively.
	microsoft.iis.requestsqueued.asp	Microsoft IIS Requests Queued ASP	count	The number of requests waiting for service from the queue.
	microsoft.iis.webservicecache.file.cache.hits.percent	Microsoft IIS WebServiceCache File Cache Hits Percent	null	The ratio of user-mode file cache hits to total cache requests (since service startup).
Agent G2 - Microsoft IIS AppPool CPU Usage and Worker Processes	microsoft_iis_appPool_CPUUsage	Microsoft IIS AppPool CPUUsage	%	Monitors Microsoft IIS Application Pool CPU Usage in percentage.
	microsoft_iis_appPool_workerProcesses_requestsElapsedTime	Microsoft IIS AppPool WorkerProcesses RequestsElapsedTime	m	Monitors Microsoft IIS Application Pool Worker Processes requests elapsed time (in minutes) for each request being handled by IIS, identified the metric name by a combination of request ID and URL. As request processes are created dynamically, we did not enable the graph for this metric.
	microsoft_iis_appPool_workerProcesses_requestsLagCount	Microsoft IIS AppPool WorkerProcesses RequestsLagCount	count	Monitors Microsoft IIS Application Pool Worker Processes Lag Count. This metric provides data if there is a lag in the worker process. If no data is available, it indicates that the metric microsoft_iis_appPool_workerProcesses_requestsElapsedTime has no data.

Agent G2 - Microsoft IIS Monitoring

Description

Agent G2 - Microsoft IIS Monitoring

Prerequisites

No prerequisite

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft IIS Custom Monitor	microsoft.iis.application.pool.state	Microsoft IIS Application Pool State		The current status of the application pool (1 - Uninitialized, 2 - Initialized, 3 - Running, 4 - Disabling, 5 - Disabled, 6 - Shutdown Pending, 7 - Delete Pending)
	microsoft.iis.connectionattemptspersec	Microsoft IIS Connection Attempts Per Sec	NULL	The rate that connections to the Web service are being attempted.
	microsoft.iis.currentconnections	Microsoft IIS Current Connections	count	Current Connections is the current number of connections established with the Web service.
	microsoft.iis.lockederrorspersec	Microsoft IIS Locked Errors Per Sec	NULL	The rate of errors due to requests that couldn't be satisfied by the server because the requested document was locked. These are generally reported as an HTTP 423 error code to the client.
	microsoft.iis.logonattemptspersec	Microsoft IIS Logon Attempts Per Sec	NULL	The rate that logons to the Web service are being attempted.
	microsoft.iis.notfounderrorspersec	Microsoft IIS Not Found Errors Per Sec	NULL	The rate of errors due to requests that couldn't be satisfied by the server because the requested document could not be found. These are generally reported as an HTTP 404 error code to the client.
	microsoft.iis.requestsnotfound.asp	Microsoft IIS Requests Not Found ASP	count	The number of requests for files that were not found.
	microsoft.iis.requestsqueued.asp	Microsoft IIS Requests Queued ASP	count	The number of requests waiting for service from the queue.
	microsoft.iis.requestsqueued.aspnet	Microsoft IIS Requests Queued ASPNET	count	The number of requests waiting to be processed.
	microsoft.iis.requestwaittime.asp	Microsoft IIS Request Wait Time ASP	ms	The number of milliseconds the most recent request was waiting in the queue.
	microsoft.iis.requestwaittime.aspnet	Microsoft IIS Request Wait Time ASPNET	ms	The number of milliseconds the most recent request was waiting in the queue.
	microsoft.iis.totalconnectionattemptsallinstances	Microsoft IIS Total Connection Attempts all Instances	count	Total Connection Attempts is the number of connections that have been attempted using the Web service (since service startup). This counter is for all instances listed.
	microsoft.iis.totallockederrors	Microsoft IIS Total Locked Errors	count	Total Locked Errors is the number of requests that couldn't be satisfied by the server because the requested was locked (since service startup). These are generally reported as an HTTP 423 error code to the client.
	microsoft.iis.totalnotfounderrors	Microsoft IIS Total Not Found Errors	count	Total Not Found Errors is the number of requests that couldn't be satisfied by the server because the requested document could not be found (since service startup). These are generally reported as an HTTP 404 error code to the client.
	microsoft.iis.webservice.total.method.requests.per.sec	Microsoft IIS Total Method Requests Per Sec	NULL	Rate at which all HTTP requests are made per second.
	microsoft.iis.webservicecache.current.file.cache.memory.usage	Microsoft IIS WebServiceCache Current File Cache Memory Usage	Bytes	Current number of bytes used for the user-mode file cache.
	microsoft.iis.webservicecache.file.cache.hits.percent	Microsoft IIS WebServiceCache File Cache Hits Percent	NULL	The ratio of user-mode file cache hits to total cache requests (since service startup).
	microsoft.iis.webservicecache.kernel.uri.cache.hits.percent	Microsoft IIS WebServiceCache Kernel URI Cache Hits Percent	NULL	The ratio of kernel URI cache hits to total cache requests (since service startup).
	microsoft.iis.webservicecache.metadata.cache.hits.percent	Microsoft IIS WebServiceCache Metadata Cache Hits Percent	NULL	The ratio of user-mode metadata cache hits to total cache requests (since service startup).
	microsoft.iis.webservicecache.output.cache.current.hits.percent	Microsoft IIS WebServiceCache Output Cache Current Hits Percent	NULL	Output Cache current hit ratio. Calculated as (H)/(H+M) where H and M represent Hits and Misses in the previous sample interval respectively.
	microsoft.iis.webservicecache.output.cache.current.memory.usage	Microsoft IIS WebServiceCache Output Cache Current Memory Usage	NULL	Current memory usage by output cache.

Agent G2 - Microsoft Lync 2013 DotNet v4 - Edge Servers

Description

Monitors MSLync 2013 Edge Servers performance data using WMI Classes

Prerequisites

NULL

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Lync 2013 DotNet v4 - Edge Servers	media.number.of.packets.dropped.by.secure.rtp.persec	MEDIA Number of packets dropped by Secure RTP Per sec	NULL	Number of packets dropped in Secure RTP module per sec
	sipeps.numberofdns.resolutionfailures.persecond	SipEps Number Of DNS Resolution Failures Per Second	NULL	Per second rate of DNS resolution failures
	media.numberofoccasions.conference.processing.is.delayed.significantly	MEDIA Number of occasions conference processing is delayed significantly	NULL	Number of occasions conference processing is delayed
	sipeps.failed.incomingmessages.persec	SipEps Failed Incoming Messages Per sec	NULL	The per-second rate of Failed Incoming Messages
	sipeps.incoming.500.internalservererror.responsespersec	SipEps Incoming 500 Internal Server Error Responses Per sec	NULL	The per-second rate of Incoming 500(Internal Server Error) Responses
	sipeps.numberofdns.resolution.failures	SipEps Number Of DNS Resolution Failures	NULL	The total number of DNS resolution failures
	sipeps.disconnections.persec	SipEps Disconnections Per sec	NULL	The per-second rate of Disconnections
	sipeps.incoming.503.serviceunavailableresponses	SipEps Incoming 503 Service Unavailable Responses	NULL	The total number of Incoming 503(Service Unavailable) Responses
	media.tcp.disconnects.because.remote.outofsync	MEDIA TCP disconnects because remote out of sync	NULL	Number of TCP disconnects happening because the received packet is out of sync.
	media.numberofconferences.with.overloadedhealth	MEDIA Number of conferences with OVERLOADED health	NULL	Total number of conferences with OVERLOADED health state. The audio/video quality for these conferences may be degraded.
	media.numberofpackets.dropped.in.transport	MEDIA Number of packets dropped in transport	NULL	Number of packets dropped in transport
	media.number.of.audio.mixes.persec	MEDIA Number of audio mixes Per sec	NULL	The number of mixes performed by the audio mixer per sec.
	sipeps.failed.outgoingmessages.persec	SipEps Failed Outgoing Messages Per sec	NULL	The per-second rate of Failed Outgoing Messages
	media.global.health	MEDIA Global health	NULL	Global health indicator - 0 means DISABLED, 1 is NORMAL, 2 is LIGHTLOAD, 3 is HEAVYLOAD and 4 is OVERLOADED

Agent G2 - Microsoft Lync 2013 Mediation Servers DotNet v4

Description

Monitors MSLync 2013 Mediation Servers

Prerequisites

NULL

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Lync 2013 Mediation Servers DotNet v4	mediation.server.total.failed.calls.caused.by.unexpected.interaction.from.a.gateway	Mediation Server Total Failed Calls Caused by unexpected Interaction from a gateway	NULL	The number of calls that failed because of unexpected interaction from a gateway
	number.of.current.inbound.calls	Number of Current Inbound Calls	NULL	The number of inbound calls in progress.
	mediation.server.total.failed.calls.caused.by.unexpected.interaction.from.the.proxy	Mediation Server Total Failed Calls Caused by unexpected Interaction from the proxy	NULL	The number of calls that failed because of unexpected interaction from the Proxy
	number.of.current.outbound.calls	Number of Current Outbound Calls	NULL	The number of outbound calls in progress.
	number.of.outbound.active.media.bypass.calls	Number of Outbound Active Meda Bypass Calls	NULL	The number of bypass calls in progress
	mediation.server.current.audio.channels.with.psm.quality.reporting	Mediation Server Current Audio Channels With PSM Quality Reporting	NULL	The number of audio channels where PSM quality reporting is enabled.
	number.of.inbound.active.media.bypass.calls	Number of Inbound Active Meda Bypass Calls	NULL	The number of media bypass calls in progress
	mediation.server.load.call.failure.index	Mediation Server Load Call Failure Index	NULL	Scaled index between zero and 100 that is related to all call failures due to heavy load
	media.relay.media.connectivity.check.failure	Media Relay Media Connectivity Check Failure	NULL	Number of media connectivity check failures.

Agent G2 - Microsoft Lync Archiving and Monitoring Servers DotNet v4

Description

Archiving Server : Archiving Server enable you to archive IM communications and meeting content for compliance reasons. If you do not have legal compliance concerns, you do not need to deploy Archiving Server. An SQL Server Back End Server is required to implement Archiving. Monitoring Server : Monitoring Server collects data about the quality of your network media, in both Enterprise voice calls and A/V conferences. It also collects call error records (CERs), which you can use to troubleshoot failed calls. Additionally, it collects usage information in the form of call detail records (CDRs) about various Lync Server features so that you can calculate return on investment of your deployment and plan the future growth of your deployment. A monitoring server role can be deployed to collect statistical usage metrics for IM, conferencing and Enterprise voice by tracking call detail records. Monitoring Server is typically collocated with the Microsoft Lync Server 2010, Archiving Server. An SQL Server Back End Server is required to implement a Monitoring Server.

Prerequisites

NULL

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Lync Archiving and Monitoring Servers DotNet v4	Arch_service_RateOfArchivingMessagesThatWereDroppedFromMessageQueuing	Rate Of Archiving Messages That Were Dropped From Message Queuing	NULL	Per second rate of dropped messages from MSMQ queue. This may be caused if there is a version mismatch between server and the agent or if malformed messages are present in the message queue.
	Arch_service_NumberOfArchivingMessagesThatFailedValidation	Number Of Archiving Messages That Failed Validation	NULL	Per second rate of messages that validation failed for. This may be caused if there is a version mismatch between server and the agent or if malformed messages are present in the message queue. Please check the agent and server version as well as the the security settings on the queue.
	MSMQService_totalmessagesinallqueues	Total Messages In All Queues	NULL	The size of the queue will vary depending on load. Verify that the queue is not increasing unbounded. Establish a baseline for the counter, and monitor the counter to ensure that it does not exceed that baseline.
	Arch_service_RateOfArchivingMessagesThatWereNotWrittenToTheDatabase	Rate Of Archiving Messages That Were Not Written To The Database	NULL	Per second rate of messages failed to be written to SQL database. This could happen if the service failed to write a critical message to the back end SQL server.
	QMS_MessageTransactionsFailed	Message Transactions Failed	NULL	This counter represents the total number of message queue/database transactions that failed since the server was started. A large number of database transactions have failed.

Agent G2 - Microsoft Lync Audio/Video Conferencing servers DotNet v4

Description

A/V Conferencing Server provides A/V conferencing functionality to your deployment. It can be collocated with Front End Server or deployed separately as a single server or A/V Conferencing Server pool. Web conferencing enables users to view, share and collaborate on documents and to share their applications and desktops with each other. A/V conferencing enables users to communicate online with real-time audio. Either A/V and Web conferencing or just Web conferencing, can be enabled when deploying conferencing.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Lync Audio/Video Conferencing servers DotNet v4	AV_MCU_NumberOfConferenceProcessingDelays	AV_MCU_NumberOfConferenceProcessingDelays	NULL	Error Threshold = 30, Experiencing transient audio quality issues due to CPU load
	AV_MCU_NumberOfDNSResolutionFailures	AV_MCU_NumberOfDNSResolutionFailures	NULL	Error Threshold = 1

Agent G2 - Microsoft Lync Back End Servers DotNet v4

Description

The Back End servers are database servers running Microsoft SQL server that provide the database services for the Front End pool. You can have a single Back End Server, but a cluster of two or more servers is recommended for failover. Back End Servers do not run any Lync Server software. The Back End Server is the second of two server roles required to be in any Lync Server 2010 Enterprise Edition deployment.

Prerequisites

NULL

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Lync Back End Servers DotNet v4	PhysicalDisk_AverageDiskWriteRate	Average Disk Write Rate	NULL	Any average numbers above 1.5 msec usually indicate poor disk performance.
	ActiveTransactionsToTheRTCDYNDatabase	Active Transactions To The RTCDYN Database	NULL	Rtcdyn: stores dynamic Lync user data such as presence information.A high number of active transactions usually indicates database transaction contention.
	LogicalDisk_AverageDiskWriteRate	Average Disk Write Rate	NULL	Any average numbers above 1.5 msec usually indicate poor disk performance.
	LogicalDisk_Percent_Idle_Time	Percent Idle Time	%	A consistently small percentage of idle time is usually an indication of poor disk performance.
	LogicalDisk_AverageDiskQueueLength	Average Disk Queue Length	NULL	Disk Queue Length per drive should be no more than double the number of spindles backing up that drive.
	PercentCommittedBytesInUse	Percent Committed Bytes In Use	%	Persentage Committed Bytes In Use is the ratio of Memory\\Committed Bytes to the Memory\\Commit Limit. Committed memory is the physical memory in use for which space has been reserved in the paging file should it need to be written to disk. The commit limit is determined by the size of the paging file. If the paging file is enlarged, the commit limit increases, and the ratio is reduced). This counter displays the current percentage value only; it is not an average
	PhysicalDisk_Percent_Idle_Time	Percent Idle Time	%	A consistently small percentage of idle time is usually an indication of poor disk performance.
	MemoryAvailable	Memory Available	MBytes	Available MBytes is the amount of physical memory, in Megabytes, immediately available for allocation to a process or for system use. It is equal to the sum of memory assigned to the standby (cached), free and zero page lists.
	LogicalDisk_AverageDiskReadRate	Average Disk Read Rate	NULL	Any average numbers above 1.5 msec usually indicate poor disk performance.
	Processor_InterruptTime	Interrupt Time	NULL	Persentage Interrupt Time is the time the processor spends receiving and servicing hardware interrupts during sample intervals. This value is an indirect indicator of the activity of devices that generate interrupts, such as the system clock, the mouse, disk drivers, data communication lines, network interface cards and other peripheral devices. These devices normally interrupt the processor when they have completed a task or require attention. Normal thread execution is suspended during interrupts. Most system clocks interrupt the processor every 10 milliseconds, creating a background of interrupt activity. suspends normal thread execution during interrupts. This counter displays the average busy time as a percentage of the sample time.
	ActiveTransactionsToTheTEMPDBDatabase	Active Transactions To The TEMPDB Database	NULL	A high number of active transactions usually indicates database transaction contention.
	CPUUtilization	CPU Utilization	%	Indicates the CPU utilization in percentage of this subject. Zero if unavailable or inapplicable
	PhysicalDisk_AverageDiskReadRate	Average Disk Read Rate	NULL	Any average numbers above 1.5 msec usually indicate poor disk performance.
	PhysicalDisk_AverageDiskQueueLength	Average Disk Queue Length	NULL	Disk Queue Length per drive should be no more than double the number of spindles backing up that drive.
	ActiveTransactionsToTheRTCDatabase	Active Transactions To The RTC Database	NULL	Rtc: stores persistent user data such as user contact lists, scheduled conferences, and access control lists. A high number of active transactions usually indicates database transaction contention.
	ProcessorPrivilegedTime	Privileged Time	NULL	Persentage Privileged Time is the percentage of elapsed time that the process threads spent executing code in privileged mode. When a Windows system service in called, the service will often run in privileged mode to gain access to system-private data. Such data is protected from access by threads executing in user mode. Calls to the system can be explicit or implicit, such as page faults or interrupts. Unlike some early operating systems, Windows uses process boundaries for subsystem protection in addition to the traditional protection of user and privileged modes. Some work done by Windows on behalf of the application might appear in other subsystem processes in addition to the privileged time in the process.
	Memory_CachedBytes	Cached Bytes	Bytes	Cache Bytes Peak is the maximum number of bytes used by the file system cache since the system was last restarted. This might be larger than the current size of the cache. This counter displays the last observed value only. it is not an average

Agent G2 - Microsoft Lync Call Quality Monitoring DotNet v4

Description

This template is based on SQL queries. In order for this template to work you need to provide the SQL credentials in a text file with the name “LyncCallQualitySQLCred” under “\Agent\conf” folder in below format: username – test password – test@123 server – test

Prerequisites

NULL

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Lync Call Quality Monitoring DotNet v4	LyncCallQuality_Stretched	LyncCallQuality Stretched	NULL	Average ratio of stretched audio samples to the total to the total number of samples. (Stretched audio is audio that has been expanded to help maintain call quality when a dropped network packet has been detected.) High values indicate significant levels of sample stretching caused by jitter, and result in audio sounding robotic or distorted.
	LyncCallQuality_PacketLoss	LyncCallQuality Packet Loss	NULL	Average rate of RTP packet loss. (Packet loss occurs when RTP packets, a protocol used for transmitting audio and video across the Internet, failed to reach their destination.) High loss rates are generally caused by congestion, lack of bandwidth, wireless congestion or interference, or an overloaded media server. Packet loss typically results in distorted or lost audio.
	LyncCallQuality_Jitter	LyncCallQuality Jitter	NULL	Jitter (ms) measures the variability of packet delay and results in a distorted or choppy audio experience. (Jitter is a measure of the "shakiness" of a call.) High jitter values are typically caused by congestion or an overloaded media server, and result in distorted or lost audio.
	LyncCallQuality_NetworkMOSDegradation	LyncCallQuality Network MOS Degradation	NULL	Average network amount of mean opinion score (MOS) degradation is an integer represents the amount of the MOS value lost to network affects.
	LyncCallQuality_Suppressed	LyncCallQuality Suppressed	NULL	Average ratio of compressed audio samples to the total number of samples. (Compressed audio is audio that has been compressed to help maintain call quality when a dropped network packet has been detected.) High values indicate significant levels of sample compression caused by jitter, and result in audio sounding accelerated or distorted.
	LyncCallQuality_RoundTripTime	LyncCallQuality Round Trip Time	NULL	Network Round Trip Time (RTT) is the most common measure of latency and is measured in ms. This measure is the average round trip time for RTP packets between endpoints. When latency is high, users will likely hear the words, but there will be delays in sentences and words.
	LyncCallQuality_Concealed	LyncCallQuality Concealed	NULL	Average ratio of concealed audio samples to the total to the total number of samples. (A concealed audio sample is a technique used to smooth out the abrupt transition that would usually be caused by dropped network packets.) High values indicate significant levels of loss concealment applied caused by packet loss or jitter, and results in distorted or lost audio.

Agent G2 - Microsoft Lync Edge Monitoring DotNet v4

Description

Monitors Microsoft Lync Edge monitoring metrics

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Lync Edge Monitoring DotNet v4	lssippeers.sipabovelimitconnectionsdroppedaccessproxiesonly	MSLync LSSIPPeers SIPAboveLimitConnectionsDroppedAccessProxiesOnly	NULL	The total number of connections that were dropped because the limit on number of incoming connections from a federated partner or clearinghouse was exceeded.

Agent G2 - Microsoft Lync Edge Servers DotNet v4

Description

Edge Server enables users of the organization to communicate and collaborate with users outside the organization’s firewalls. These external users can include the organization’s own users who are currently working offsite, users from federated partner organizations, and outside users who have been invited to join conferences hosted on Lync Server deployment. Edge Server also enables connectivity to public IM connectivity services, including Windows Live, AOL, and Yahoo! Monitors TCP Active relay authentication, data sessions, etc.

Prerequisites

NULL

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Lync Edge Servers DotNet v4	AudioVideoEdge_UDPActiveRelayDataSessions	AudioVideoEdge UDP Active Relay Data Sessions	NULL	This component monitor returns the number of active relay data sessions over UDP.
	SIP_ActiveConnections	SIP Active Connections	NULL	This component monitor returns the number of established connections that are currently active. A connection is considered established when peer credentials are verified (e.g. via MTLS), or the peer receives a 2xx response. You will need to baseline this counter by testing and monitoring the user load. This returned value should be less than 15,000 connections per Front-End.
	AudioVideoEdge_UDPAllocateRequestRate	AudioVideoEdge UDP Allocate Request Rate	NULL	This component monitor returns the per-second rate of Allocate Requests over UDP. You will need to baseline this counter by testing and monitoring the user load.
	SIP_IncomingRequestsRate	SIP Incoming Requests Rate	NULL	This component monitor returns the rate of received requests, per second. You will need to baseline this counter by testing and monitoring the user load.
	AudioVideoEdge_UDPActiveRelaySessionsWithAllocatedPort	AudioVideoEdge UDP Active Relay Sessions With Allocated Port	NULL	This component monitor returns the number of active relay sessions with a UDP port allocation.
	SIP_AverageOutgoingQueueDelay	SIP Average Outgoing Queue Delay	NULL	This component monitor returns the average time, in seconds, that messages have been delayed in outgoing queues. Check the Outgoing Queue Delay for delays in sending messages to other servers or clients that could be causing messages to be accumulated in the server. The server will drop client connections if it is in a throttle state and messages stay in the outgoing queue for more than 32 seconds.
	AudioVideoEdge_TCPAveragePacketLatency	AudioVideoEdge TCP Average Packet Latency	NULL	This component monitor returns the average latency for a valid data request over TCP in milliseconds. The returned value should be as low as possible.
	SIP_AverageIncomingMessageProcessingTime	SIP Average Incoming Message Processing Time	NULL	The average time (in seconds) it takes to process an incoming message. This could indicate if this server is too busy and is unable to process user requests in timely fashion. This might be a temporary condition. If the problem persists, please ensure that hardware and software requirements for this server meet the user usage characteristics.
	AudioVideoEdge_UDPAveragePacketLatency	AudioVideoEdge UDP Average Packet Latency	NULL	This component monitor returns the average latency for a valid data request over UDP in milliseconds. The returned value should be as low as possible.
	AudioVideoEdge_TCPAllocateRequestsExceedingPortLimit	AudioVideoEdge TCP Allocate Requests Exceeding Port Limit	NULL	This component monitor returns the number of allocate requests over TCP that exceeded the port limit. If the value is greater than zero, this could indicate an attempt to misuse the port. This error occurs when there is an unexpectedly high rate of requests over TCP for ports associated with the same user ID. This could be an indication of an attempt to misuse the A/V Edge Server. Check that the profile of network traffic to the A/V Edge Server is in line with expected usage. A network level trace can be used to determine if there is unusual amount of traffic originating from a single source. If the situation persists then enable tracing to identify the originator of messages requesting more than the permitted number of ports to allow further troubleshooting of the cause.
	SIP_AverageHoldingTimeForIncomingMessage	SIP Average Holding Time For Incoming Message	NULL	This component monitor returns the average time that the server held the incoming messages currently being processed. If this counter is more than 10 seconds (12 seconds maximum), then the server goes into throttling mode and only allows one outstanding transaction per client connection. If this value goes down to 3 seconds, then the server allows up to 20 outstanding transactions per client connection.
	AudioVideoEdge_TCPActiveRelayAuthenticatedSessions	AudioVideoEdge TCP Active Relay Authenticated Sessions	NULL	This component monitor returns the number of active relay sessions over TCP
	SIP_ExternalMessagesWithInternallySupportedDomain	SIP External Messages With Internally Supported Domain	NULL	This component monitor returns the per-second rate of messages received at the external edge with an internally supported domain.
	SIP_ExternalMessagesWithAllowedPartnerDomain	SIP External Messages With Allowed Partner Domain	NULL	This component monitor returns the per-second rate of messages received at the external edge with an allowed partner server domain.
	AudioVideoEdge_TCPPacketReceiveRate	AudioVideoEdge TCP Packet Receive Rate	NULL	This component monitor returns the number of packets received per second by the relay over TCP. You will need to baseline this counter by testing and monitoring the user load.
	WebConferencingEdge_CurrentNumberOfActiveConnectionsToWebConferencingServer	WebConferencingEdge Current Number Of Active Connections To Web Conferencing Server	NULL	The total number of server connections that are currently active. Expected number of connections to each Web Conferencing Server is 4. If there are no connections currently active to Web Conferencing Server, the reason could be a incorrect configuration where the Web Conferencing Servers are not able to connect to the Web Conferencing Edge Server. It is also possible that the Web Conferencing Server has malfunctioned and is not running in a healthy state. Make sure that the Web Conferencing Server is in a healthy state
	SIP_503ResponseRate	SIP 503 Response Rate	Responses per sec	This component monitor returns the rate of 503 responses generated by the server, per second. The 503 code corresponds to the server being unavailable. On a healthy server, you should not receive this code at a steady rate. However, during ramp up, after a server has been brought back online, there may be some 503 responses. Once all users get back in and the server returns to a stable state, there should no longer be any 503 responses returned.
	SIP_IncomingMessageRate	SIP Incoming Message Rate	Messages per sec	This component monitor returns the rate of received messages, per second. You will need to baseline this counter by testing and monitoring the user load.
	AudioVideoEdge_TCPAllocateRequestRate	AudioVideoEdge TCP Allocate Request Rate	NULL	This component monitor returns the per-second rate of Allocate Requests over TCP. You will need to baseline this counter by testing and monitoring the user load.
	AV_Authentication_Edge_BadRequestsReceivedPerSecond	AV Authentication Edge Bad Requests Received Per Second	NULL	The number of bad requests received/sec. This error occurs when an unexpectedly high rate of invalid requests is received by the A/V Authentication Service. This could be the result of an attempt to misuse the A/V Authentication Service. If the situation persists then enable Microsoft Lync Server 2010 logging for SIP messages to the A/V Authentication Service to identify the source of the invalid requests.
	AudioVideoEdge_TCPActiveRelaySessionsWithAllocatedPort	AudioVideoEdge TCP Active Relay Sessions With Allocated Port	NULL	This component monitor returns the number of active relay sessions with a TCP port allocation.
	SIP_ExternalMessagesWithConfiguredAllowedDomain	SIP External Messages With Configured Allowed Domain	NULL	This component monitor returns the per-second rate of messages received at the external edge with a configured allowed domain.
	AudioVideoEdge_TCPAuthenticationFailureRate	AudioVideoEdge TCP Authentication Failure Rate	NULL	This component monitor returns the per-second rate of failed attempts to authenticate with the relay over TCP. The returned value should be as low as possible.
	SIP_504ResponseRate	SIP 504 Response Rate	Responses per sec	This component monitor returns the rate of 504 responses generated by the server, per second. A few 504 responses to clients (for clients disconnecting abruptly) is to be expected, but this counter mainly indicates connectivity issues with other servers. It can indicate connection failures or delays connecting to remote servers. Check the number of SIP sends outstanding to validate this issue.
	AudioVideoEdge_UDPPortsInAllocatedPool	AudioVideoEdge UDP Ports In Allocated Pool	NULL	This component monitor returns the number of UDP ports available in the Allocated Port Pool. This monitor should be more than zero. If it reaches zero there is a resource issue.
	AudioVideoEdge_UDPPacketSentRate	AudioVideoEdge UDP Packet Sent Rate	NULL	This component monitor returns the number of packets sent per second by the relay over UDP. You will need to baseline this counter by testing and monitoring the user load.
	AudioVideoEdge_UDPPacketDropRate	AudioVideoEdge UDP Packet Drop Rate	NULL	This component monitor returns the per-second rate of packets over UDP dropped by the relay. The returned value should be as low as possible. This error occurs when an unexpectedly high rate of User Datagram Protocol (UDP) packets is received at the Media Relay (A/V Edge server) causing some packets to be discarded. This could be the result of system overload or an indication of an attempt to misuse the MR. To resolve this, check that the profile of network traffic to the MR is in line with expected usage. If the traffic exceeds 250 Mbps per interface, increase the Receive and Transmit buffer size on the associated network adapter network adapters to three times the default values.If the cause is a general system overload, increase capacity of the deployed MR function. A network level trace can be used to determine if there is an unusual amount of traffic originating from a single source. If the situation persists, enable tracing to check the network source of sessions
	AudioVideoEdge_UDPPacketReceiveRate	AudioVideoEdge UDP Packet Receive Rate	NULL	This component monitor returns the number of packets received per second by the relay over UDP. You will need to baseline this counter by testing and monitoring the user load.
	SIP_ConnectionsRefusedDueToServerOverload	SIP Connections Refused Due To Server Overload	NULL	The per-second rate of the connections that were refused with Service Unavailable response because the server was overloaded. If the problem persists, please ensure that hardware and software requirements for this server meets the user usage characteristics.
	SIP_ActiveTLSConnections	SIP Active TLS Connections	NULL	This component monitor returns the number of established TLS connections that are currently active. A TLS connection is considered established when the peer certificate, and possibly the host name, are verified for a trust relationship. You will need to baseline this counter by testing and monitoring the user load.
	AudioVideoEdge_UDPActiveRelayAuthenticatedSessions	AudioVideoEdge UDP Active Relay Authenticated Sessions	NULL	This component monitor returns the number of active relay sessions over UDP
	AudioVideoEdge_TCPPacketDropRate	AudioVideoEdge TCP Packet Drop Rate	NULL	This component monitor returns the per-second rate of packets over UDP dropped by the relay. The returned value should be as low as possible. This error occurs when an unexpectedly high rate of TCP packets is received at the Media Relay (A/V Edge server) causing some packets to be discarded. This could be the result of system overload or an indication of an attempt to misuse the MR. To resolve this, check that the profile of network traffic to the MR is in line with expected usage. If the traffic exceeds 250 Mbps per interface, increase the Receive and Transmit buffer size on the associated network adapter network adapters to three times the default values.If the cause is a general system overload, increase capacity of the deployed MR function. A network level trace can be used to determine if there is an unusual amount of traffic originating from a single source. If the situation persists, enable tracing to check the network source of sessions
	AudioVideoEdge_UDPAuthenticationFailureRate	AudioVideoEdge UDP Authentication Failure Rate	NULL	This component monitor returns the per-second rate of failed attempts to authenticate with the relay over UDP. The returned value should be as low as possible.
	AudioVideoEdge_TCPPortsInAllocatedPool	AudioVideoEdge TCP Ports In Allocated Pool	NULL	This component monitor returns the number of TCP ports available in the Allocated Port Pool. This monitor should be more than zero. If it reaches zero there is a resource issue.
	AudioVideoEdge_UDPAllocateRequestsExceedingPortLimit	AudioVideoEdge UDP Allocate Requests Exceeding Port Limit	NULL	This component monitor returns the number of allocate requests over UDP that exceeded the port limit. If the value is greater than zero, this could indicate an attempt to misuse the port. This error occurs when there is an unexpectedly high rate of requests over UDP for ports associated with the same user ID. This could be an indication of an attempt to misuse the A/V Edge Server. Check that the profile of network traffic to the A/V Edge Server is in line with expected usage. A network level trace can be used to determine if there is unusual amount of traffic originating from a single source. If the situation persists then enable tracing to identify the originator of messages requesting more than the permitted number of ports to allow further troubleshooting of the cause.
	AudioVideoEdge_TCPPacketSentRate	AudioVideoEdge TCP Packet Sent Rate	NULL	This component monitor returns the number of packets sent per second by the relay over TCP. You will need to baseline this counter by testing and monitoring the user load.
	AudioVideoEdge_TCPActiveRelayDataSessions	AudioVideoEdge TCP Active Relay Data Sessions	NULL	This component monitor returns the number of active relay data sessions over TCP.

Agent G2 - Microsoft Lync Front End Servers DotNet v4

Description

Monitors Microsoft Lync Front End Server metrics

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Lync Front End Servers DotNet v4	datamcu.health.state	DATAMCU Health State	NULL	The Multipoint Conferencing Units (MCU) health counters give an indication of the overall system health; these should be 0 at all times, indicating normal operation. The current health of the data sharing MCU. 0 = Normal. 1 = Loaded. 2 = Full. 3 = Unavailable.
	sip.avgholdingtime.for.incomingmessage	SIP Avg Holding Time For Incoming Message	NULL	This component monitor returns the average time that the server held the incoming messages currently being processed. If this counter is more than 10 seconds (12 seconds maximum), then the server goes into throttling mode and only allows one outstanding transaction per client connection. If this value goes down to 3 seconds, then the server allows up to 20 outstanding transactions per client connection.
	sip.tls.connections.active	SIP TLS Connections Active	NULL	This component monitor returns the number of established TLS connections that are currently active. A TLS connection is considered established when the peer certificate, and possibly the host name, are verified for a trust relationship. You will need to baseline this counter by testing and monitoring the user load.
	audiovideoconferencing.numberofoccasionsconferenceprocessing.is.delayed	Audio Video Conferencing Number Of Occasions Conference Processing Is Delayed	NULL	Number of occasions conference processing is delayed. This issue may occur if the Audio Video Conferencing server is overloaded, or is not getting enough CPU resources to process audio in real time. To resolve this issue, please check the affected machine for overall CPU consumption and remove any unnecessary competing processes. If there are no competing issues, and there is a large number of users due to which Audio Video Conferencing Server is unable to process audio in real time, consider adding more hardware to service the usage with acceptable quality.
	datamcu.draining.state	DATAMCU Draining State	NULL	The Multipoint Conferencing Units (MCU) health counters give an indication of the overall system health; these should be 0 at all times, indicating normal operation. The current draining status of the data sharing MCU. 0 = Not requesting to drain. 1 = Requesting to drain. 2 = Draining.
	sip.events.in.processing	SIP Events In Processing	NULL	This component monitor returns the number of SIP transactions, or dialog state change events, that are currently being processed. You will need to baseline this counter by testing and monitoring the user load.
	sip.avg.outgoing.queuedelay	SIP Avg Outgoing Queue Delay	NULL	This component monitor returns the average time, in seconds, that messages have been delayed in outgoing queues. Check the Outgoing Queue Delay for delays in sending messages to other servers or clients that could be causing messages to be accumulated in the server. The server will drop client connections if it is in a throttle state and messages stay in the outgoing queue for more than 32 seconds.
	callpark.failed.callparkrequests	Failed Call Park Requests	NULL	The total number of park requests that failed.
	msmq.totalmessages.inall.queues	Total Messages In All Queues	NULL	The size of the queue will vary depending on load. Verify that the queue is not increasing unbounded. Establish a baseline for the counter, and monitor the counter to ensure that it does not exceed that baseline.
	sip.sends.outstanding	SIP Sends Outstanding	NULL	This component monitor returns the number of messages that are currently present in the outgoing queues. If you receive error message 504, investigate the results from this counter. Doing so will indicate which servers are having problems. To do so, you will need to change the instance from _Total, to the server hostname. If this counter is high then the problem is probably not on this server. This counter can also be high if there are network latency issues.
	memory.pages.persec	Memory Pages Per Sec	NULL	If a page has to be retrieved from the disk instead of from the memory, there is a negative impact to performance; the rate at which pages in memory are swapped with those in the disk needs to be below a 500 pages per second. If the rate is above this number, it indicates a lack of memory available to service requests quickly and will result in a substantial system slow-down.
	addressbook.search.failure.rate	Address Book Search Failure Rate	NULL	The per-second rate of failed address book search requests. It could be due to backend database performance issues. Verify backend database is running and accessible.
	applicationsharing.mcu.drainingstate	Application Sharing MCU Draining State	NULL	The Multipoint Conferencing Units (MCU) health counters give an indication of the overall system health; these should be 0 at all times, indicating normal operation. The current draining status of the application sharing MCU. 0 = Not requesting to drain. 1 = Requesting to drain. 2 = Draining.
	sip.connectionsrefused.dueto.serveroverload	SIP Connections Refused Due To Server Overload	NULL	The per-second rate of the connections that were refused with Service Unavailable response because the server was overloaded. If the problem persists, please ensure that hardware and software requirements for this server meets the user usage characteristics.
	user.services.dbstore.sproclatency	User Services DBStore Sproc Latency	MS	This component monitor returns the average time, in milliseconds, it takes to execute a stored procedure call. A healthy state is considered to be less than 100 ms. Server health decreases as latency increases to 12 seconds, when server throttling begins.
	lscommunicatorwebapp.throttledclientdatacollaboration.connectionspersecond	LS Communicator Web App Throttled Client Data Collaboration Connections Per Second	NULL	The number of Data Collaboration client connections closed due to throttling per second. Client Data Collaboration was closed because client failed to read data in a timely manner. This may indicate a network failure or organized attack. Check client network connectivity to Lync Web App.
	sip.incoming.messages.timedout	SIP Incoming Messages Timed Out	NULL	The number of incoming messages currently being held by the server for processing for more than the maximum tracking interval. This server is too busy and is unable to process user requests in timely fashion.
	immcu.throttled.sip.connections	IMMCU Throttled SIP Connections	NULL	The number of throttled Sip connections . Peer is not processing requests in a timely fashion.This can happen if the peer machine is overloaded.
	avmcu.number.of.audiovideoconferences	AVMCU Number of Audio video conferences	NULL	Number of audio-video conferences. Ideally it should be evenly distributed across all frontend servers.
	addressbook.filedownload.failedrequestspersecond	Address Book File Download Failed Requests Per Second	NULL	The per-second rate of failed Address Book file requests. High rate of failure can be caused by authentication issues or network connectivity issues. Check Lync Server event log for failure causes and correct
	sip.connections.active	SIP Connections Active	NULL	This component monitor returns the number of established connections that are currently active. A connection is considered established when peer credentials are verified (e.g. via MTLS), or the peer receives a 2xx response. You will need to baseline this counter by testing and monitoring the user load. This returned value should be less than 15,000 connections per Front-End.
	sip.avg.flow.controldelay	SIP Avg Flow Control Delay	NULL	This component monitor returns the average delay, in seconds, in message processing when the socket is flow-controlled. You will need to baseline this counter by testing and monitoring the server's health. The returned value should be as low as possible.
	sip.incoming.request.rate	SIP Incoming Request Rate	NULL	This component monitor returns the rate of received requests, per second. You will need to baseline this counter by testing and monitoring the user load.
	datamcu.stateofsession.queues	DataMCU State Of Session Queues	NULL	The state of the session queues. It indicates if the Data MCU is over loaded.
	sip.address.space.usage	SIP Address Space Usage	NULL	This component monitor returns the percentage of available address space currently in use by the server process. The returned value should be as low as possible.
	datamcu.estimated.conferenceworkitems.load	DataMCU Estimated Conference Work Items Load	NULL	The estimated time to process all pending items on the session queues measured in milliseconds.
	asmcu.number.of.applicationsharingconferences	ASMCU Number Of Application Sharing Conferences	NULL	Number of application-sharing conferences. Ideally it should be evenly distributed across all frontend servers.
	im.numberofconnected.im.users	IM Number Of Connected IM Users	NULL	This component monitor returns the number of connected instant messaging users in all conferences. You will need to baseline this counter by testing and monitoring the user load.
	applicationsharing.mcu.healthstate	Application Sharing MCU Health State	NULL	The Multipoint Conferencing Units (MCU) health counters give an indication of the overall system health; these should be 0 at all times, indicating normal operation. The current health of the application sharing MCU. 0 = Normal. 1 = Loaded. 2 = Full. 3 = Unavailable.
	dbstore.queue.latency	DB Store Queue Latency	NULL	This component monitor returns the average time, in milliseconds, that a request is held in the queue of the Back-End Database Server. If the topology is healthy, this counter averages less than 100 ms. Occasional spikes are acceptable. The value will be higher on Front-End Servers that are located at the site opposite the location of the Back-End Database Servers. This value can increase if the Back-End Database Server is having performance problems or if network latency is too high. If the returned value is high, check both network latency and the health of the Back-End Database Server. When server throttling begins, server health decreases as latency increases to 12 seconds.
	lscommunicatorwebapp.faileddatacollaboration.authentication.requestspersecond	LS Communicator Web App Failed Data Collaboration Authentication Requests Per Second	NULL	The number of failed Data Collaboration authentication request per second. Attempts to authenticate incoming client connections for data collaboration failed. This may indicate a network attack.
	datamcu.numberof.datasharing.conferences	DATAMCU Number Of Data Sharing Conferences	NULL	Number of data-sharing conferences. Ideally it should be evenly distributed across all frontend servers.
	callpark.failedtransfers.to.fallbackuri	Call Park Failed Transfers To Fall Back URI	NULL	The total number of failed fallback attempts. The fallback destination might not be reachable.
	user.services.numberoffailed.httpconnections	User Services Number Of Failed HTTP Connections	NULL	This component monitor returns the rate of connection attempt failures, per second. You will need to baseline this counter by testing and monitoring the server's health.
	addressbook.search.response.time	Address Book Search Response Time	NULL	The average processing time for a address book search request in milliseconds. It could be due to backend database performance issues. Verify CPU load on backend database machine. Upgrade hardware if needed.
	lscommunicatorwebapp.numberofdatacollaborationconnectionfailures.withdatacollaborationservers	LS Communicator Web App Number Of Data Collaboration Connection Failures With Data Collaboration Servers	NULL	The number of Data Collaboration connection failures with Data Collaboration servers. Connection closed by local party or remote party or network issues. Check availability of Web Conferencing Server servers.
	sipmessagespersecond.droppeddue.to.unknowndomain	SIP Messages Per Second Dropped Due To Unknown Domain	NULL	The per-second rate of messages that could not be routed because the message domain is not configured and does not appear to belong to a federated partner. The Access Edge Server received SIP messages with an unknown domain. If the number is high then the Access Edge Server may be under attack.
	sip.incoming.message.rate	SIP Incoming Message Rate	NULL	This component monitor returns the rate of received messages, per second. You will need to baseline this counter by testing and monitoring the user load.
	im.number.of.activeconferences	IM Number Of Active Conferences	NULL	This component monitor returns the number of active instant messaging conferences. You will need to baseline this counter by testing and monitoring the user load.
	sip.flowcontrolled.connections.dropped	SIP Flow Controlled Connections Dropped	NULL	This component monitor returns the total number of connections dropped because of excessive flow-control. You will need to baseline this counter by testing and monitoring the server's health. The returned value should be as low as possible.
	sip.503.response.rate	SIP 503 Response Rate	NULL	This component monitor returns the rate of 503 responses generated by the server, per second. The 503 code corresponds to the server being unavailable. On a healthy server, you should not receive this code at a steady rate. However, during ramp up, after a server has been brought back online, there may be some 503 responses. Once all users get back in and the server returns to a stable state, there should no longer be any 503 responses returned.
	dbstore.queue.depth	DB Store Queue Depth	NULL	The average number of database requests waiting to be executed. The backend might be busy and is unable to respond to requests quickly.This might be a temporary condition. If the problem persists please ensure that the hardware and software requirements meet the user usage characteristics.
	sip.page.file.usage	SIP Page File Usage	NULL	This component monitor returns the percentage of available page file space currently in use by the server process. The returned value should be as low as possible.
	im.with.throttled.sipconnections	IM With Throttled SIP Connections	NULL	This component monitor returns the number of throttled Sip connections. If the value is greater than ten, it could indicate that Peer is not processing requests in a timely fashion. This can happen if the peer machine is overloaded. Peer is defined as the connected servers, adjacent Front-End servers, or MCUs in the same EE Pool.
	sip.504.response.rate	SIP 504 Response Rate	NULL	This component monitor returns the rate of 504 responses generated by the server, per second. A few 504 responses to clients (for clients disconnecting abruptly) is to be expected, but this counter mainly indicates connectivity issues with other servers. It can indicate connection failures or delays connecting to remote servers. Check the number of SIP sends outstanding to validate this issue.
	expand.distributionlist.soapexception.rate	Expand Distribution List SOAP Exception Rate	NULL	The per-second rate of Soap exceptions.
	expand.distributionlist.responsetimeinms	Expand Distribution List Response Time In ms	NULL	Average processing time for a distribution list expansion request. This component monitor returns the average time, in milliseconds, it takes to expand a distribution list.
	callparkfailedrequests.because.no.orbitisavailable	Call Park Failed Requests Because No Orbit Is Available	NULL	The total number of park requests failed because no orbit available. Consider adding more orbits using management console or the Power Shell commands to manage orbit ranges.
	sip.500.response.rate	SIP 500 Response Rate	NULL	This component monitor returns the rate of 500 responses generated by the server, per second. This can indicate that there is a server component that is not functioning correctly.

Agent G2 - Microsoft Lync Mediation Monitoring DotNet v4

Description

Monitors Microsoft Lync Mediation monitoring metrics

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Lync Mediation Monitoring DotNet v4	lsmediationservermediarelay.candidatesmissing	MSLync LSMediationServerMediaRelay CandidatesMissing	NULL	Number of times Media stack does not have Media relay candidates.

Agent G2 - Microsoft Lync Mediation Servers DotNet v4

Description

Mediation Server is a necessary component for implementing Enterprise Voice and dial-in conferencing. It translates signaling and, in some configurations, media between your internal Lync Server infrastructure and a public switched telephone network (PSTN) gateway, IP-PBX, or a Session Initiation Protocol (SIP) trunk. Mediation Server role be collocated with the Front End Server role in a similar manner as the Web and A/V conferencing roles. Monitors current audio channels with PSM quality reporting, load call failure index, etc.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Lync Mediation Servers DotNet v4	media.relay.media.connectivity.check.failure	Media Relay Media Connectivity Check Failure	NULL	Number of media connectivity check failures.
	mediation.server.current.audio.channels.with.psm.quality.reporting	Mediation Server Current Audio Channels With PSM Quality Reporting	NULL	The number of audio channels where PSM quality reporting is enabled.
	mediation.server.load.call.failure.index	Mediation Server Load Call Failure Index	NULL	Scaled index between zero and 100 that is related to all call failures due to heavy load
	number.of.outbound.active.media.bypass.calls	Number of Outbound Active Meda Bypass Calls	NULL	The number of bypass calls in progress
	number.of.inbound.active.media.bypass.calls	Number of Inbound Active Meda Bypass Calls	NULL	The number of media bypass calls in progress
	mediation.server.total.failed.calls.caused.by.unexpected.interaction.from.a.gateway	Mediation Server Total Failed Calls Caused by unexpected Interaction from a gateway	NULL	The number of calls that failed because of unexpected interaction from a gateway
	mediation.server.total.failed.calls.caused.by.unexpected.interaction.from.the.proxy	Mediation Server Total Failed Calls Caused by unexpected Interaction from the proxy	NULL	The number of calls that failed because of unexpected interaction from the Proxy
	number.of.current.outbound.calls	Number of Current Outbound Calls	NULL	The number of outbound calls in progress.
	number.of.current.inbound.calls	Number of Current Inbound Calls	NULL	The number of inbound calls in progress.

Agent G2 - Microsoft Lync Performance Monitoring DotNet v4

Description

Monitors Microsoft Lync Performance monitoring metrics

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Lync Performance Monitoring DotNet v4	processor.percentusertime	Processor PercentUserTime	%	% User Time is the percentage of elapsed time the processor spends in the user mode. User mode is a restricted processing mode designed for applications, environment subsystems, and integral subsystems. The alternative, privileged mode, is designed for operating system components and allows direct access to hardware and all memory. The operating system switches application threads to privileged mode to access operating system services. This counter displays the average busy time as a percentage of the sample time.
	processor.percentidletime	Processor PercentIdleTime	%	% Idle Time is the percentage of time the processor is idle during the sample interval
	networkinterface.outputqueuelength	NetworkInterface OutputQueueLength	NULL	Output Queue Length is the length of the output packet queue (in packets). If this is longer than two, there are delays and the bottleneck should be found and eliminated, if possible. Since the requests are queued by the Network Driver Interface Specifica
	lsusrvendpointcache.usrvactiveregisteredendpoints	MSLync LSUSrvEndPointCache UsrvActiveRegisteredEndPoints	NULL	Total number of active endpoints connected to this Server.
	lsusrvregdbstore.usrvthrottledrequestspersec	MSLync LSUSrvREGDBStore UsrvThrottledrequestsPersec	NULL	The number of requests that were rejected/sec with a retry-after since the database queue latency was high.
	memory.cachebytespeak	Memory CacheBytesPeak	NULL	Cache Bytes Peak is the maximum number of bytes used by the system file cache since the system was last restarted. This might be larger than the current size of the cache. This counter displays the last observed value only; it is not an average.
	lssippeers.sipsendstimedoutpersec	MSLync LSSIPPeers SIPSendsTimedOutPerSec	NULL	The per-second rate of sends dropped because they stayed in outgoing (send) queue for too long.
	lswebauthproviderrelatedcalls.webtotalvalidatecertcallstothecertauthprovider	MSLync LSWEBAuthProviderrelatedcalls WEBTotalvalidatecercallstothecertauthprovider	NULL	The total number of validate cert calls to the cert auth provider
	mssqlrtclocalbuffermanager.pagelifeexpectancy	MSLync MSSQLRTCLOCALBufferManager Pagelifeexpectancy	NULL	Number of seconds a page will stay in the buffer pool without references.
	lsusrvshareddbstore.usrvthrottledrequestspersec	MSLync LSUSrvSHAREDDBStore UsrvThrottledrequestsPersec	NULL	The number of requests that were rejected/sec with a retry-after since the database queue latency was high.
	lsusrvconferencemcuallocator.usrvcreateconferencerequeststimedout	MSLync LSUSrvConferenceMcuAllocator UsrvCreateConferenceRequestsTimedOut	NULL	Number of Create Conference requests that did not receive a response in time.
	lsusrvdbstore.usrvthrottledrequestspersec	MSLync LSUSrvDDBStore UsrvThrottledrequestsPersec	NULL	The number of requests that were rejected/sec with a retry-after since the database queue latency was high.
	lsasmcuasmcuconferences.asmcuconnectedusers	MSLync LSAsMcuAsMcuConferences ASMCUConnectedUsers	NULL	The number of connected Users
	lssipauthentication.sipauthenticationsystemerrorspersec	MSLync LSSIPAuthentication SIPAuthenticationSystemErrosPerSec	NULL	The per-second rate of authentication failures caused by system errors (due to low memory conditions or otherwise).
	lssipprotocol.sipincomingrequestsdroppedpersec	MSLync LSSIPProtocol SIPIncomingRequestsDroppedPersec	NULL	The per-second rate of incoming requests dropped because they could not be processed (due to bad headers, insufficient routing information, server resource allocation failure).
	lsasmcucccpprocessing.asmcunumberofadduserrequestsfailed	MSLync LSAsMcuCCCPProcessing ASMCUNumberofadduserrequestsfailed	NULL	Number of add-user failed responses returned.
	lssippeers.sipflowcontrolledconnections	MSLync LSSIPPeers SIPFlowControlledConnections	NULL	The number of connections that are currently being flow-controlled (no socket receives are posted).
	lswebdistributionlistexpansion.webtimedoutactivedirectoryrequestspersec	MSLync LSWEBDistributionListExpansion WEBTimedoutActiveDirectoryRequestsPersec	NULL	The per-second rate of timed out Active Directory requests
	lsimmcuimmcuconferences.immcuconnectedusers	MSLync LSImMcuIMMcuConferences IMMCUConnectedUsers	NULL	The number of connected users in all conferences
	aspnetappsv4030319.requestsrejected	MSLync ASPNET4030319 RequestsRejected	NULL	The number of requests rejected because the application request queue was full.
	lsasmcucccpprocessing.asmcucccpmessagesretriedpersec	MSLync LSAsMcuCCCPProcessing ASMCUCCCMessagesRetriedPerSec	NULL	The total number of retried CCCP messages per second.
	lsasmcucccpprocessing.asmcucurrentcccpmessagequeuesize	MSLync LSAsMcuCCCPProcessing ASMCUCurrentCCCPMessageQueueSize	NULL	The number of CCCP messages currently in the send queue.
	lsroutingappsemergencycallrouting.routingappsnumberofincomingfailureresponses	MSLync LSRoutingAppsEmergencyCallRouting RoutingAppsNumberofincomingfailureresponses	NULL	Number of times an Emergency Call failure response was received from Gateway.
	lssipprotocol.sipincomingresponsesdroppedpersec	MSLync LSSIPProtocol SIPIncomingResponsesDroppedPersec	NULL	The per-second rate of incoming responses dropped because they could not be processed (due to bad headers, insufficient routing information, server resource allocation failure).
	lssiploadmanagement.sipincomingmessagesheldaboveoverloadwatermark	MSLync LSSIPLoadManagement SIPIncomingMessagesHeldAboveOverloadWatermark	NULL	The number of incoming messages currently being held by the server for processing for more than the overload watermark time threshold.
	lsusrvclustermanager.usrvnumberoffailuresofreplicationoperationssenttootherreplicaspersecond	MSLync LSUSrvClusterManager USrvNumberoffailuresofreplicationoperationssenttootherReplicaspersecond	NULL	The per-second rate of replication operation failures
	networkinterface.packetsreceiveddiscarded	NetworkInterface PacketsReceivedDiscarded	NULL	Packets Received Discarded is the number of inbound packets that were chosen to be discarded even though no errors had been detected to prevent their delivery to a higher-layer protocol. One possible reason for discarding packets could be to free up buff
	networkinterface.packetsoutbounddiscarded	NetworkInterface PacketsOutboundDiscarded	NULL	Packets Outbound Discarded is the number of outbound packets that were chosen to be discarded even though no errors had been detected to prevent transmission. One possible reason for discarding packets could be to free up buffer space.
	lsxmppfederationsipinstantmessaging.xmppfederationfailureimdnssentpersec	MSLync LSXmppFederationSIPInstantMessaging XmppFederationFailureIMDNssentPersec	NULL	Failure IMDNs sent/sec
	lsjoinlauncherjoinlauncherservicefailures.joinlauncherjoinfailures	MSLync LSJoinLauncherJoinLauncherServiceFailures JOINLAUNCHERJoinFailures	NULL	The number of join failures

Agent G2 - Microsoft SharePoint 2007 Performance Counters DotNet v4

Description

Monitors SharePoint 2007 Performance Counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft SharePoint 2007 Performance Counters DotNet v4	processor.percentprocessortime	Processor PercentProcessorTime	NULL	% Processor Time is the percentage of elapsed time that the processor spends to execute a non-Idle thread. It is calculated by measuring the percentage of time that the processor spends executing the idle thread and then subtracting that value from 100%.
	netclrdata.sqlclienttotalnumberfailedconnects	NETCLRData SqlClientTotalNumberfailedconnects	NULL	The total number of connection open attempts that have failed for any reason
	pagingfile.percentusage	PagingFile PercentUsage	%	The amount of the Page File instance in use in percent.
	networkinterface.outputqueuelength	NetworkInterface OutputQueueLength	NULL	Output Queue Length is the length of the output packet queue (in packets). If this is longer than two, there are delays and the bottleneck should be found and eliminated, if possible. Since the requests are queued by the Network Driver Interface Specifica

Agent G2 - Microsoft SharePoint 2007 Performance Counters Extended DotNet v4

Description

Microsoft SharePoint 2007 Performance Counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft SharePoint 2007 Performance Counters Extended DotNet v4	server.workitemshortages	Server WorkItemShortages	NULL	The number of times STATUS_DATA_NOT_ACCEPTED was returned at receive indication time. This occurs when no work item is available or can be allocated to service the incoming request. Indicates whether the InitWorkItems or MaxWorkItems parameters might need to be adjusted.
	aspnetapplications.requestsrejected	ASPNETApplications RequestsRejected	NULL	The number of requests rejected because the application request queue was full.
	aspnet.workerprocessrestarts	ASPNET WorkerProcessRestarts	NULL	Number of times a worker process has restarted on the machine.
	processor.percentprivilegedtime	Processor PercentPrivilegedTime	%	% Privileged Time is the percentage of elapsed time that the process threads spent executing code in privileged mode. When a Windows system service in called, the service will often run in privileged mode to gain access to system-private data. Such data is protected from access by threads executing in user mode. Calls to the system can be explicit or implicit, such as page faults or interrupts. Unlike some early operating systems, Windows uses process boundaries for subsystem protection in addition to the traditional protection of user and privileged modes. Some work done by Windows on behalf of the application might appear in other subsystem processes in addition to the privileged time in the process.
	aspnetapplications.requestwaittime	ASPNETApplications RequestWaitTime	MS	The number of milliseconds the most recent request was waiting in the queue.
	networkinterface.bytestotalpersec	NetworkInterface BytesTotalPersec	NULL	Bytes Total/sec is the rate at which bytes are sent and received over each network adapter, including framing characters. Network Interface\\Bytes Total/sec is a sum of Network Interface\\Bytes Received/sec and Network Interface\\Bytes Sent/sec.
	networkinterface.bytessentpersec	NetworkInterface BytesSentPersec	NULL	Bytes Sent/sec is the rate at which bytes are sent over each network adapter, including framing characters. Network Interface\\Bytes Sent/sec is a subset of Network Interface\\Bytes Total/sec.
	logicaldisk.currentdiskqueuelength	LogicalDisk CurrentDiskQueueLength	NULL	Current Disk Queue Length is the number of requests outstanding on the disk at the time the performance data is collected. It also includes requests in service at the time of the collection. This is a instantaneous snapshot, not an average over the time interval. Multi-spindle disk devices can have multiple requests that are active at one time, but other concurrent requests are awaiting service. This counter might reflect a transitory high or low queue length, but if there is a sustained load on the disk drive, it is likely that this will be consistently high. Requests experience delays proportional to the length of this queue minus the number of spindles on the disks. For good performance, this difference should average less than two.
	officeserversearcharchivalplugin.totaldocsinfirstqueue	OfficeServerSearchArchivalPlugin Totaldocsinfirstqueue	NULL	Number of documents in the first queue of the archival plug-in. This should be less than 500 during a crawl, and very low at other times. If the counter is above 500, the search database drive on the database server is probably a bottleneck.
	memory.committedbytes	Memory CommittedBytes	NULL	Committed Bytes is the amount of committed virtual memory, in bytes. Committed memory is the physical memory which has space reserved on the disk paging file(s). There can be one or more paging files on each physical drive. This counter displays the last observed value only; it is not an average.
	aspnetapplications.requestsexecuting	ASPNETApplications RequestsExecuting	NULL	The number of requests currently executing.
	networkinterface.packetsreceivederrors	NetworkInterface PacketsReceivedErrors	NULL	Packets Received Errors is the number of inbound packets that contained errors preventing them from being deliverable to a higher-layer protocol.
	physicaldisk.percentidletime	PhysicalDisk PercentIdleTime	%	% Idle Time reports the percentage of time during the sample interval that the disk was idle.
	process.workingset	Process WorkingSet	NULL	Working Set is the current size, in bytes, of the Working Set of this process. The Working Set is the set of memory pages touched recently by the threads in the process. If free memory in the computer is above a threshold, pages are left in the Working Set of a process even if they are not in use. When free memory falls below a threshold, pages are trimmed from Working Sets. If they are needed they will then be soft-faulted back into the Working Set before leaving main memory.
	process.pagefaultspersec	Process PageFaultsPersec	NULL	Page Faults/sec is the rate at which page faults by the threads executing in this process are occurring. A page fault occurs when a thread refers to a virtual memory page that is not in its working set in main memory. This may not cause the page to be fetched from disk if it is on the standby list and hence already in main memory, or if it is in use by another process with whom the page is shared.
	processor.percentusertime	Processor PercentUserTime	%	% User Time is the percentage of elapsed time the processor spends in the user mode. User mode is a restricted processing mode designed for applications, environment subsystems, and integral subsystems. The alternative, privileged mode, is designed for operating system components and allows direct access to hardware and all memory. The operating system switches application threads to privileged mode to access operating system services. This counter displays the average busy time as a percentage of the sample time.
	process.handlecount	Process HandleCount	NULL	The total number of handles currently open by this process. This number is equal to the sum of the handles currently open by each thread in this process.
	physicaldisk.currentdiskqueuelength	PhysicalDisk CurrentDiskQueueLength	NULL	Current Disk Queue Length is the number of requests outstanding on the disk at the time the performance data is collected. It also includes requests in service at the time of the collection. This is a instantaneous snapshot, not an average over the time interval. Multi-spindle disk devices can have multiple requests that are active at one time, but other concurrent requests are awaiting service. This counter might reflect a transitory high or low queue length, but if there is a sustained load on the disk drive, it is likely that this will be consistently high. Requests experience delays proportional to the length of this queue minus the number of spindles on the disks. For good performance, this difference should average less than two.
	officeserversearchindexercatalogs.queriessucceeded	OfficeServerSearchIndexerCatalogs QueriesSucceeded	NULL	Number of queries that produce successful searches.
	process.privatebytes	Process PrivateBytes	NULL	Private Bytes is the current size, in bytes, of memory that this process has allocated that cannot be shared with other processes.
	memory.pagespersec	Memory PagesPersec	NULL	Pages/sec is the rate at which pages are read from or written to disk to resolve hard page faults. This counter is a primary indicator of the kinds of faults that cause system-wide delays.
	aspnetapplications.requestsinapplicationqueue	ASPNETApplications RequestsInApplicationQueue	NULL	The number of requests in the application request queue.
	memory.availablebytes	Memory AvailableBytes	NULL	Available Bytes is the amount of physical memory, in bytes, immediately available for allocation to a process or for system use. It is equal to the sum of memory assigned to the standby (cached), free and zero page lists.
	process.percentprocessortime	Process PercentProcessorTime	%	% Processor Time is the percentage of elapsed time that all of process threads used the processor to execution instructions. An instruction is the basic unit of execution in a computer, a thread is the object that executes instructions, and a process is the object created when a program is run. Code executed to handle some hardware interrupts and trap conditions are included in this count.
	logicaldisk.percentidletime	LogicalDiskPercentIdleTime	%	% Idle Time reports the percentage of time during the sample interval that the disk was idle.
	logicaldisk.percentdisktime	LogicalDisk PercentDiskTime	%	% Disk Time is the percentage of elapsed time that the selected disk drive was busy servicing read or write requests.
	networkinterface.packetsoutbounderrors	NetworkInterface PacketsOutboundErrors	NULL	Packets Outbound Errors is the number of outbound packets that could not be transmitted because of errors.
	system.contextswitchespersec	System ContextSwitchesPersec	NULL	Context Switches/sec is the combined rate at which all processors on the computer are switched from one thread to another. Context switches occur when a running thread voluntarily relinquishes the processor, is preempted by a higher priority ready thread, or switches between user-mode and privileged (kernel) mode to use an Executive or subsystem service.
	memory.cachebytes	Memory CacheBytes	NULL	Cache Bytes the size, in bytes, of the portion of the system file cache which is currently resident and active in physical memory. The Cache Bytes and Memory\\\\System Cache Resident Bytes counters are equivalent. This counter displays the last observed value only; it is not an average.
	officeserversearchindexercatalogs.queries	OfficeServerSearchIndexerCatalogs Queries	NULL	Number of queries posted to the server.
	physicaldisk.percentdisktime	PhysicalDisk PercentDiskTime	%	% Disk Time is the percentage of elapsed time that the selected disk drive was busy servicing read or write requests.
	redirector.serversessionshung	Redirector ServerSessionsHung	NULL	Number of active sessions that are timed out and unable to proceed due to a lack of response from the remote server.
	networkinterface.bytesreceivedpersec	NetworkInterface BytesReceivedPersec	NULL	Bytes Received/sec is the rate at which bytes are received over each network adapter, including framing characters. Network Interface\\Bytes Received/sec is a subset of Network Interface\\Bytes Total/sec.
	processor.interruptspersec	Processor InterruptsPersec	NULL	Interrupts/sec is the average rate, in incidents per second, at which the processor received and serviced hardware interrupts. It does not include deferred procedure calls (DPCs), which are counted separately. This value is an indirect indicator of the activity of devices that generate interrupts, such as the system clock, the mouse, disk drivers, data communication lines, network interface cards, and other peripheral devices. These devices normally interrupt the processor when they have completed a task or require attention. Normal thread execution is suspended. The system clock typically interrupts the processor every 10 milliseconds, creating a background of interrupt activity. This counter displays the difference between the values observed in the last two samples, divided by the duration of the sample interval.

Agent G2 - Microsoft SharePoint 2010 - Performance Counters DotNet v4

Description

Template for Sharepoint 2010 monitors AvgDataAdapterQueryDuration, AvgDataConnectionSubmitDuration, AvgDiskQueueLength, AvgDiskReadQueueLength, AvgDiskWriteQueueLength, etc.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft SharePoint 2010 - Performance Counters DotNet v4	PercentTimeinGC	PercentTimeinGC	%	% Time in GC is the percentage of elapsed time that was spent in performing a garbage collection (GC) since the last GC cycle. This counter is usually an indicator of the work done by the Garbage Collector on behalf of the application to collect and compact memory. This counter is updated only at the end of every GC and the counter value reflects the last observed value; its not an average.
	RequestWaitTime	RequestWaitTime	NULL	RPC Requests outstanding is the current number of outstanding RPC requests.
	DataConnectionSubmitCompletedRate	DataConnectionSubmitCompletedRate	NULL	The rate at which data connection submits completed in form filling sessions.
	AvgDataAdapterQueryDuration	AvgDataAdapterQueryDuration	NULL	The average time to complete a data connection query in form filling sessions.
	DataConnectionQueryFailureRate	DataConnectionQueryFailureRate	NULL	The rate of failures for data connection queries in form filling sessions.
	DiskReadsPersec	DiskReadsPersec	NULL	Disk Reads/sec is the rate of read operations on the disk.
	PercentIdleTime	PercentIdleTime	NULL	% Idle Time reports the percentage of time during the sample interval that the disk was idle.
	PageFaultsPersec	PageFaultsPersec	psec	Page Faults/sec is the average number of pages faulted per second. It is measured in number of pages faulted per second because only one page is faulted in each fault operation, hence this is also equal to the number of page fault operations. This counter includes both hard faults (those that require disk access) and soft faults (where the faulted page is found elsewhere in physical memory.) Most processors can handle large numbers of soft faults without significant consequence. However, hard faults, which require disk access, can cause significant delays.
	TransactionsStartedRate	TransactionsStartedRate	NULL	The rate at which transactions started in form filling sessions.
	TransactionsCompletedRate	TransactionsCompletedRate	NULL	The rate at which transactions completed in form filling sessions.
	AvgSessionDuration	AvgSessionDuration	NULL	The average time to complete a form filling session, summed up over all transactions in the session.
	AvgTransactionDuration	AvgTransactionDuration	NULL	The average time to complete a transaction in form filling sessions.
	BytesSentPersec	BytesSentPersec	NULL	This component monitor returns the data rate of outgoing IMA network traffic.
	RequestsQueued	RequestsQueued	NULL	The number of requests waiting to be processed
	GetRequestsPersec	GetRequestsPersec	NULL	The rate HTTP requests using the GET method are made. Get requests are the most common HTTP request.
	AvgDataConnectionSubmitDuration	AvgDataConnectionSubmitDuration	NULL	The average time to complete a data connection submit in form filling sessions.
	AvgDiskReadQueueLength	AvgDiskReadQueueLength	NULL	Average Disk Read Queue Length is the average number of read requests that were queued for the selected disk during the sample interval. The value for this counter should always be under 2. This is the most reliable counter to use when the SQL instance is using external SAN storage for its databases.
	DataConnectionQueryCompletedRate	DataConnectionQueryCompletedRate	NULL	The rate at which data connection queries completed in form filling sessions.
	SessionCompletedRate	SessionCompletedRate	NULL	The average time to complete a data connection submit in form filling sessions.
	CurrentConnections	CurrentConnections	NULL	The number of active connections to the WWW service.
	DiskWritesPersec	DiskWritesPersec	NULL	Disk Writes/sec is the rate of write operations on the disk.
	ContextSwitchesPersec	ContextSwitchesPersec	NULL	A context switch occurs when the kernel switches the processor from one thread to another-for example, when a thread with a higher priority than the running thread becomes ready. The System Context Switches/sec counter in System Monitor reports systemwide context switches
	SessionStartedRate	SessionStartedRate	NULL	The rate at which form filling sessions started.
	AvgDiskWriteQueueLength	AvgDiskWriteQueueLength	NULL	Average Disk Write Queue Length is the average number of write requests that were queued for the selected disk during the sample interval. The value for this counter should always be under 2. This is the most reliable counter to use when the SQL instance is using external SAN storage for its databases.
	BytesReceivedPersec	BytesReceivedPersec	NULL	This component monitor returns the data rate of incoming Independent Management Architecture(IMA) network traffic.
	ProcessorQueueLength	ProcessorQueueLength	NULL	The System/Processor Queue Length counter shows how many threads are ready in the processor queue, but not currently able to use the processor.
	RequestsPerSec	RequestsPerSec	NULL	The number of requests executed per second.
	PercentUsage	PercentUsage	NULL	The amount of the Page File instance in use in percent.
	TotalConnectionsAttemptsallinstances	TotalConnectionsAttemptsallinstances	NULL	counter is for all instances listed.
	DataConnectionSubmitStartedRate	DataConnectionSubmitStartedRate	NULL	The rate at which data connection submits started in form filling sessions.
	DataConnectionSubmitFailureRate	DataConnectionSubmitFailureRate	NULL	The rate of failures for data connection submits in form filling sessions.
	AvgDiskQueueLength	AvgDiskQueueLength	NULL	AvgDiskQueueLength

Agent G2 - Microsoft SharePoint 2013 DotNet v4 - Extended

Description

Monitors SharePoint 2013 Performance data using WMI Classes

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft SharePoint 2013 DotNet v4 - Extended	synchronization.execresourceacquiresacqexcllitepersec	Synchronization ExecResourceAcquiresAcqExclLitePersec	NULL	Frequency of first exclusive acquires from ExAcquireResourceExclusiveLite.
	searchcontentprocessing.numbercallbacksavailable	SearchContentProcessing NumberCallbacksAvailable	NULL	Current number of callbacks available for consumption, but not yet consumed.
	ipsecdriver.activesecurityassociations	IPsecDriver ActiveSecurityAssociations	NULL	Active Security Associations is the number of active quick mode security associations.
	sqlserverworkloadgroupstats.activeparallelthreads	SQLServerWorkloadGroupStats Activeparallelthreads	NULL	Number of threads used by parallel queries in the workload group. Serial queries and the main thread of parallel queries are not included in this number.
	searchplatformservices.messagequeueavgblockedtime	SearchPlatformServices Messagequeueavgblockedtime	NULL	Message queue average blocked time
	httpserviceurlgroups.allrequests	HTTPServiceUrlGroups AllRequests	NULL	Total number of HTTP requests made for this site
	teredoserver.interedoservererrorpacketsauthenticationerror	TeredoServer InTeredoServerErrorPacketsAuthenticationError	NULL	Total error packets( authentication error) received by the Teredo server.
	sqlserverssispipeline130.blobbytesread	SQLServerSSISPipeline130 BLOBbytesread	NULL	The number of bytes of binary large object (BLOB) data that the data flow engine has read from all sources.
	msdtcbridge4000.averageparticipantcommitresponsetime	MSDTCBridge4000 Averageparticipantcommitresponsetime	MS	Average time in milliseconds for the WS-AT service to receive a Commit message response from a participant.
	sqlserverfiletable.avgtimedeletefiletableitem	SQLServerFileTable AvgtimedeleteFileTableitem	MS	Average time (in milliseconds) taken to delete a FileTable item.
	netclrnetworking.bytesreceived	NETCLRNetworking BytesReceived	NULL	The cumulative total number of bytes received over all open socket connections since the process was started. This number includes data and any protocol information that is not defined by the TCP/IP protocol.
	sqlserverssispipeline110.blobbytesread	SQLServerSSISPipeline110 BLOBbytesread	NULL	The number of bytes of binary large object (BLOB) data that the data flow engine has read from all sources.
	searchsubmissionservice.numberabortedsessions	SearchSubmissionService NumberAbortedSessions	NULL	The total number of aborted sessions since the start of the component.
	w3svcw3wp.activeflushedentries	W3SVCW3WP ActiveFlushedEntries	NULL	Number of file handles cached in user-mode that will be closed when all current transfers complete.
	sqlserveravailabilityreplica.bytesreceivedfromreplicapersec	SQLServerAvailabilityReplica BytesReceivedfromReplicaPersec	NULL	Total bytes receieved from the availability replica
	sqlagentalerts.activatedalerts	SQLAgentAlerts Activatedalerts	NULL	The number of Alerts that have activated since the last SQL Server restart.
	servicemodelservice4000.calls	ServiceModelService4000 Calls	NULL	The number of calls to this service. http://go.microsoft.com/fwlink/?LinkId=222530
	ipsecikev1ipv6.activemainmodesas	IPsecIKEv1IPv6 ActiveMainModeSAs	NULL	Active Main Mode SAs is the number of currently active main mode security associations.
	usbhub.percenttotalbandwidthusedforinterrupt	USBHub PercentTotalBandwidthUsedforInterrupt	%	Displays the percentage of BW reserved for interrupt transfers
	ipsecikev1ipv4.activemainmodesas	IPsecIKEv1IPv4 ActiveMainModeSAs	NULL	Active Main Mode SAs is the number of currently active main mode security associations.
	sqlservermemorynode.databasenodememorykb	SQLServerMemoryNode DatabaseNodeMemoryKB	NULL	Amount of memory the server is using on this node for database pages.
	windowssharepointfoundation.activeheapcount	SharePointFoundation ActiveHeapCount	NULL	The number of native heaps in use by the process
	msrs2011windowsservicesharepointmode.activesessions	MSRS2011WindowsServiceSharePointMode ActiveSessions	NULL	Number of active sessions stored in the report server database. This counter provides a cumulative count of all usable browser sessions generated from report subscriptions, whether they are still active or not.
	teredoclient.interedobubble	TeredoClient InTeredoBubble	NULL	Total bubble packets received by the Teredo client.
	searchgathererdatabasecomponentssharepointserversearch.countcommittransactions	SearchGathererDatabaseComponentsSharePointServerSearch CountCommitTransactions	NULL	Count Commit Transactions
	ipsecikev2ipv6.activemainmodesas	IPsecIKEv2IPv6 ActiveMainModeSAs	NULL	Active Main Mode SAs is the number of currently active main mode security associations.
	searchsplookupservice.avgdocsumlookuptime	SearchSPLookupService AvgDocSumLookupTime	NULL	The average number of milliseconds required to perform just a docsum retrieval
	httpservice.currenturiscached	HTTPService CurrentUrisCached	NULL	Total number of URIs currently cached by the kernel
	securitysystemwidestatistics.activeschannelsessioncacheentries	SecuritySystemWideStatistics ActiveSchannelSessionCacheEntries	NULL	This counter tracks the number of Secure Sockets Layer (SSL) entries that are currently stored in the secure channel (Schannel) session cache and that are currently in use. The Schannel session cache stores information about successfully established sess
	sharepointservercacheinstances.cachehitratio	SharePointServerCacheinstances CacheHitRatio	NULL	Cache hit ratio
	msrs2016windowsservicesharepointmode.activesessions	MSRS2016WindowsServiceSharePointMode ActiveSessions	NULL	Number of active sessions stored in the report server database. This counter provides a cumulative count of all usable browser sessions generated from report subscriptions, whether they are still active or not.
	sqlagentstatistics.sqlserverrestarted	SQLAgentStatistics SQLServerrestarted	NULL	The number of times the SQL Server has been successfully restarted by SQL Server Agent, since the last SQL Server Agent restart.
	sqlserverbrokertostatistics.avglengthofbatchedwrites	SQLServerBrokerTOStatistics AvgLengthofBatchedWrites	NULL	Average Number of Transmission Objects saved in a batch.
	msrs2016webservicesharepointmode.activesessions	MSRS2016WebServiceSharePointMode ActiveSessions	NULL	Number of active sessions. This counter provides a cumulative count of all browser sessions generated from report executions, whether they are still active or not.
	wsmanquotastatistics.activeoperations	WSManQuotaStatistics ActiveOperations	NULL	Displays the current number of active operations for all users.
	searchgathererdatabasessharepointserversearch.databasesize	SearchGathererDatabasesSharePointServerSearch DatabaseSize	NULL	Database Size
	sqlservermemorybrokerclerks.internalbenefit	SQLServerMemoryBrokerClerks Internalbenefit	NULL	The internal value of memory for entry count pressure, in ms per page per ms, multiplied by 10 billion and truncated to an integer
	searchflowstatistics.numberinbounditemstotal	SearchFlowStatistics NumberInboundItemsTotal	NULL	Total number of items placed on input queues
	searchhostcontroller.componentrestarts	SearchHostController ComponentRestarts	NULL	Number of restarts of a search component since start of the Host Controller
	searchcontentrouter.indextime	SearchContentRouter IndexTime	MS	The number of milliseconds it takes from submitting a document until a callback is received
	sqlagentjobs.activejobs	SQLAgentJobs Activejobs	NULL	Number of running jobs
	wfpv6.activeinboundconnections	WFPv6 ActiveInboundConnections	NULL	Active Inbound Connections is the number of current inbound connections allowed by the Windows Filtering Platform.
	sqlserverdeprecatedfeatures.usage	SQLServerDeprecatedFeatures Usage	NULL	Feature usage since last SQL Server startup
	securityperprocessstatistics.contexthandles	SecurityPerProcessStatistics ContextHandles	NULL	This counter tracks the number of context handles in use by a given process. Context handles are associated with security contexts established between a client application and a remote peer.
	wasw3wp.activelistenerchannels	WASW3WP ActiveListenerChannels	NULL	Number of currently active listener channels in the worker process.
	smsvchost4000.connectionsacceptedovernetpipe	SMSvcHost4000 ConnectionsAcceptedovernetpipe	NULL	The total number of named pipe connections accepted over net.pipe.
	aspnetv4030319.applicationrestarts	ASPNETV4030319 ApplicationRestarts	NULL	Number of times the application has been restarted during the web server's lifetime.
	genericikev1authipandikev2.authipmainmodenegotiationtime	GenericIKEv1AuthIPandIKEv2 AuthIPMainModeNegotiationTime	MS	AuthIP Main Mode Negotiation Time is the number of milliseconds taken for the last Authenticated IP main mode security association negotiated.
	ipsecdosprotection.currentstateentries	IPsecDoSProtection CurrentStateEntries	NULL	Current State Entries is the number of state entries in the table. A state entry is a pair of IPv6 addresses that is authorized to pass through from a public to an internal interface.
	searchanalysisengineanalyses.activefiles	SearchAnalysisEngineAnalyses ActiveFiles	NULL	The number of files stored on disk
	wfp.providercount	WFP ProviderCount	NULL	Provider Count is the number of providers registered with the Windows Filtering Platform.
	sqlserverqueryexecution.localdataaccesspersec	SQLServerQueryExecution LocaldataaccessPersec	NULL	Total number of local data access per second
	sqlserverresourcepoolstats.activememorygrantamountkb	SQLServerResourcePoolStats ActivememorygrantamountKB	NULL	Total amount of granted memory in kilobytes in the resource pool.
	pacerpipe.averagepacketsinnetcard	PacerPipe Averagepacketsinnetcard	NULL	The average number of packets in the network card over the last sampling period.
	searchanalysisengineanalyticsprocessingcomponents.failedtasks	SearchAnalysisEngineAnalyticsProcessingComponents FailedTasks	NULL	The number of tasks that have failed since the analytics processing component was started
	searchanalysisengine.activeanalyticsprocessingcomponents	SearchAnalysisEngine ActiveAnalyticsProcessingComponents	NULL	The number of currently registered analytics processing components in the analysis engine
	wfpv4.activeinboundconnections	WFPv4 ActiveInboundConnections	NULL	Active Inbound Connections is the number of current inbound connections allowed by the Windows Filtering Platform.
	teredorelay.interedorelayerrorpacketsdestinationerror	TeredoRelay InTeredoRelayErrorPacketsDestinationError	NULL	Total error packets( destination error) received by the Teredo relay.
	httpservicerequestqueues.arrivalrate	HTTPServiceRequestQueues ArrivalRate	NULL	Total number of requests arriving at the server
	processorinformation.percentc1time	ProcessorInformation PercentC1Time	%	% C1 Time is the percentage of time the processor spends in the C1 low-power idle state. % C1 Time is a subset of the total processor idle time. C1 low-power idle state enables the processor to maintain its entire context and quickly return to the running
	ipsecauthipipv6.activeextendedmodesas	IPsecAuthIPIPv6 ActiveExtendedModeSAs	NULL	Active Extended Mode SAs is the number of currently active extended mode security associations.
	searchlinguistics.companyexclusiondictionaryentries	SearchLinguistics CompanyExclusionDictionaryEntries	NULL	Number of entries contained in the current exclusion dictionary for company extraction.
	msrs2011webservicesharepointmode.activesessions	MSRS2011WebServiceSharePointMode ActiveSessions	NULL	Number of active sessions. This counter provides a cumulative count of all browser sessions generated from report executions, whether they are still active or not.
	netmemorycache40.cacheentries	NetMemoryCache40 CacheEntries	NULL	The number of entries within the cache.
ipsecikev2ipv4.activemainmodesas	IPsecIKEv2IPv4 ActiveMainModeSAs	NULL	Active Main Mode SAs is the number of currently active main mode security associations.
sqlserverdatabasereplica.filebytesreceivedpersec	SQLServerDatabaseReplica FileBytesReceivedPersec	NULL	Amount of filestream data received by the availability replica for the database

Agent G2 - Microsoft SharePoint 2013 DotNet v4 - Performance Counters

Description

Template for SharePoint 2013 application monitors.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft SharePoint 2013 DotNet v4 - Performance Counters	DataConnectionSubmitStartedRate	DataConnectionSubmitStartedRate	NULL	The rate at which data connection submits started in form filling sessions.
	PercentIdleTime	PercentIdleTime	NULL	% Idle Time reports the percentage of time during the sample interval that the disk was idle.
	AvgSessionDuration	AvgSessionDuration	NULL	The average time to complete a form filling session, summed up over all transactions in the session.
	TotalConnectionsAttemptsallinstances	TotalConnectionsAttemptsallinstances	NULL	counter is for all instances listed.
	DataConnectionSubmitCompletedRate	DataConnectionSubmitCompletedRate	NULL	The rate at which data connection submits completed in form filling sessions.
	RequestsPerSec	RequestsPerSec	NULL	The number of requests executed per second.
	AvgDiskQueueLength	AvgDiskQueueLength	NULL	AvgDiskQueueLength
	SessionStartedRate	SessionStartedRate	NULL	The rate at which form filling sessions started.
	TransactionsStartedRate	TransactionsStartedRate	NULL	The rate at which transactions started in form filling sessions.
	CurrentConnections	CurrentConnections	NULL	The number of active connections to the WWW service.
	DiskWritesPersec	DiskWritesPersec	NULL	Disk Writes/sec is the rate of write operations on the disk.
	RequestWaitTime	RequestWaitTime	NULL	RPC Requests outstanding is the current number of outstanding RPC requests.
	AvgDiskWriteQueueLength	AvgDiskWriteQueueLength	NULL	Average Disk Write Queue Length is the average number of write requests that were queued for the selected disk during the sample interval. The value for this counter should always be under 2. This is the most reliable counter to use when the SQL instance is using external SAN storage for its databases.
	DiskReadsPersec	DiskReadsPersec	NULL	Disk Reads/sec is the rate of read operations on the disk.
	DataConnectionQueryCompletedRate	DataConnectionQueryCompletedRate	NULL	The rate at which data connection queries completed in form filling sessions.
	AvgDataAdapterQueryDuration	AvgDataAdapterQueryDuration	NULL	The average time to complete a data connection query in form filling sessions.
	ProcessorQueueLength	ProcessorQueueLength	NULL	The System/Processor Queue Length counter shows how many threads are ready in the processor queue, but not currently able to use the processor.
	BytesSentPersec	BytesSentPersec	NULL	This component monitor returns the data rate of outgoing IMA network traffic.
	AvgDataConnectionSubmitDuration	AvgDataConnectionSubmitDuration	NULL	The average time to complete a data connection submit in form filling sessions.
	GetRequestsPersec	GetRequestsPersec	NULL	The rate HTTP requests using the GET method are made. Get requests are the most common HTTP request.
	TransactionsCompletedRate	TransactionsCompletedRate	NULL	The rate at which transactions completed in form filling sessions.
	DataConnectionSubmitFailureRate	DataConnectionSubmitFailureRate	NULL	The rate of failures for data connection submits in form filling sessions.
	BytesReceivedPersec	Bytes Received Per sec	NULL	This component monitor returns the data rate of incoming Independent Management Architecture(IMA) network traffic.
	AvgTransactionDuration	AvgTransactionDuration	NULL	The average time to complete a transaction in form filling sessions.
	RequestsQueued	RequestsQueued	NULL	The number of requests waiting to be processed
	PercentTimeinGC	PercentTimeinGC	%	% Time in GC is the percentage of elapsed time that was spent in performing a garbage collection (GC) since the last GC cycle. This counter is usually an indicator of the work done by the Garbage Collector on behalf of the application to collect and compact memory. This counter is updated only at the end of every GC and the counter value reflects the last observed value; its not an average.
	DataConnectionQueryFailureRate	DataConnectionQueryFailureRate	NULL	The rate of failures for data connection queries in form filling sessions.
	PercentUsage	PercentUsage	NULL	The amount of the Page File instance in use in percent.
	ContextSwitchesPersec	ContextSwitchesPersec	NULL	A context switch occurs when the kernel switches the processor from one thread to another-for example, when a thread with a higher priority than the running thread becomes ready. The System Context Switches/sec counter in System Monitor reports systemwide context switches
	AvgDiskReadQueueLength	AvgDiskReadQueueLength	NULL	Average Disk Read Queue Length is the average number of read requests that were queued for the selected disk during the sample interval. The value for this counter should always be under 2. This is the most reliable counter to use when the SQL instance is using external SAN storage for its databases.
	SessionCompletedRate	SessionCompletedRate	NULL	The average time to complete a data connection submit in form filling sessions.
	PageFaultsPersec	PageFaultsPersec	psec	Page Faults/sec is the average number of pages faulted per second. It is measured in number of pages faulted per second because only one page is faulted in each fault operation, hence this is also equal to the number of page fault operations. This counter includes both hard faults (those that require disk access) and soft faults (where the faulted page is found elsewhere in physical memory.) Most processors can handle large numbers of soft faults without significant consequence. However, hard faults, which require disk access, can cause significant delays.

Agent G2 - Microsoft SharePoint Performance Counters DotNet v4

Description

Monitors SharePoint Performance data using WMI Classes

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft SharePoint Performance Counters DotNet v4	QueriesSucceeded	QueriesSucceeded	NULL	NULL
	Queries	Queries	NULL	NULL
	TotalMethodRequestsPersec	TotalMethodRequestsPersec	NULL	NULL
	RequestWaitTime	RequestWaitTime	NULL	RPC Requests outstanding is the current number of outstanding RPC requests.
	RequestsPerSec	RequestsPerSec	NULL	The number of requests executed per second.
	ConnectionAttemptsPersec	ConnectionAttemptsPersec	NULL	The rate, in seconds, at which connections to the WWW service have been attempted since the service started.
	RequestExecutionTime	RequestExecutionTime	NULL	The amount of time (in milliseconds) that it took to execute the most recent request
	CacheTotalEntries	CacheTotalEntries	NULL	NULL
	WorkerProcessRestarts	WorkerProcessRestarts	NULL	Number of times a worker process has restarted on the machine.
	ApplicationRestarts	ApplicationRestarts	NULL	Number of times the application has been restarted during the web server lifetime
	RequestsRejected	RequestsRejected	NULL	The number of requests rejected because the request queue was full
	CacheTotalHitRatio	CacheTotalHitRatio	NULL	NULL
	RequestsQueued	RequestsQueued	NULL	The number of requests waiting to be processed
	CurrentConnections	CurrentConnections	NULL	The number of active connections to the WWW service.

Agent G2 - Microsoft SQL 2000 - Performance Counters DotNet v4

Description

Template for Microsoft SQL 2000 Performance counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft SQL 2000 - Performance Counters DotNet v4	OpenConnectionCount	OpenConnectionCount	NULL	The total number of transport connections currently open
	LoginsPersec	LoginsPersec	NULL	The number of user logins per second. Any value over 2 may indicate insufficient connection pooling.
	LockTimeoutsPersec	LockTimeoutsPersec	NULL	Shows the number of lock requests per second that timed out, including internal requests for NOWAIT locks. A value greater than zero might indicate that user queries are not completing. The lower this value is, the better. Ideally should be <1
	NumberofDeadlocksPersec	NumberofDeadlocksPersec	NULL	Number of lock requests, per second, which resulted in a deadlock. Since only a COMMIT, ROLLBACK, or deadlock can terminate a transaction (excluding failures or errors), this is an important value to track. Excessive deadlocking indicates a table or index design error or bad application design. Use the Profiler's ability to track deadlocks.
	UsedLogSpace	UsedLogSpace	NULL	The cumulative used size of all the log files in the database.
	DataSpaceofDB	DataSpaceofDB	%	Space utilization for the Data files.
	UserConnections	UserConnections	NULL	This shows the number of user connections, not the number of users, that are currently connected to SQL Server. A single user can have multiple connections open, and also that multiple people can share a single user connection. This indicates how busy the server is.
	TaskLimitReached	TaskLimitReached	NULL	This counter reports the total number of times that a queue monitor would have started a new task, but did not because the maximum number of tasks for the queue is already running.
	TasksAbortedPersec	TasksAbortedPersec	NULL	This reports the number of activation stored procedure tasks that end with an error, or are aborted by a queue monitor for failing to receive messages.
	ReceiveIPerOsPersec	ReceiveIPerOsPersec	NULL	The number of transport receives I/O per second. Note that a transport receive I/O may contain more than one message fragment.
	SQLReCompilationsPersec	SQLReCompilationsPersec	NULL	Number of times, per second, that Transact-SQL objects attempted to be executed but had to be recompiled before completion. This number should be at or near zero, since recompiles can cause deadlocks and exclusive compile locks. This counter's value should follow in proportion to Batch Requests/sec and SQL Compilations/sec. This needs to be nil in your system as much as possible.
	BrokerTransactionRollbacks	BrokerTransactionRollbacks	NULL	The number of rolled-back transactions that contained DML statements related to Service Broker, such as SEND and RECEIVE.
	SQLRECEIVEsPersec	SQLRECEIVEsPersec	NULL	The number of Transact-SQL RECEIVE statements processed per second.
	AverageLatchWaitTimems	AverageLatchWaitTimems	Milliseconds	The average latch wait time, in milliseconds, for any latch requests that had to wait. This value should generally correlate to Latch Waits/sec and move up or down with it accordingly.
	SQLSENDsPersec	SQLSENDsPersec	NULL	The number of Transact-SQL SEND statements executed per second.
	SQLCompilationsPersec	SQLCompilationsPersec	NULL	Number of times that Transact-SQL compilations occurred, per second (including recompiles). The lower this value is the better. High values often indicate excessive adhoc querying and should be as low as possible. If excessive adhoc querying is happening, try rewriting the queries as procedures or invoke the queries using sp_executeSQL. When rewriting isn't possible, consider using a plan guide or setting the database to parameterization forced mode.
	LatchWaitsPersec	LatchWaitsPersec	NULL	The number of latches in the last second that had to wait. Latches are lightweight means of holding a very transient server resource, such as an address in memory. Ideally should be < 10.
	MSSQLCacheHitRatio	MSSQLCacheHitRatio	NULL	Ratio between cache hits and lookups.
	TransactionsPersec	TransactionsPersec	NULL	Number of transactions started for the database.
	SendIPerOsPersec	SendIPerOsPersec	NULL	The number of transport send I/Os per second. Note that a transport send I/O may contain more than one message fragment.
	LogoutsPersec	LogoutsPersec	NULL	The number of user logouts per second. Any value over 2 may indicate insufficient connection pooling.

Agent G2 - Microsoft SQL 2005 - Performance Counters DotNet v4

Description

Template for MSSQL 2005 Performance Monitors

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft SQL 2005 - Performance Counters DotNet v4	ReceiveIPerOsPersec	ReceiveIPerOsPersec	NULL	The number of transport receives I/O per second. Note that a transport receive I/O may contain more than one message fragment.
	SQLSENDsPersec	SQLSENDsPersec	NULL	The number of Transact-SQL SEND statements executed per second.
	SQLCompilationsPersec	SQLCompilationsPersec	NULL	Number of times that Transact-SQL compilations occurred, per second (including recompiles). The lower this value is the better. High values often indicate excessive adhoc querying and should be as low as possible. If excessive adhoc querying is happening, try rewriting the queries as procedures or invoke the queries using sp_executeSQL. When rewriting isn't possible, consider using a plan guide or setting the database to parameterization forced mode.
	UsedLogSpace	UsedLogSpace	NULL	The cumulative used size of all the log files in the database.
	BrokerTransactionRollbacks	BrokerTransactionRollbacks	NULL	The number of rolled-back transactions that contained DML statements related to Service Broker, such as SEND and RECEIVE.
	SendIPerOsPersec	SendIPerOsPersec	NULL	The number of transport send I/Os per second. Note that a transport send I/O may contain more than one message fragment.
	LogoutsPersec	LogoutsPersec	NULL	The number of user logouts per second. Any value over 2 may indicate insufficient connection pooling.
	MSSQLCacheHitRatio	MSSQLCacheHitRatio	NULL	Ratio between cache hits and lookups.
	UserConnections	UserConnections	NULL	This shows the number of user connections, not the number of users, that are currently connected to SQL Server. A single user can have multiple connections open, and also that multiple people can share a single user connection. This indicates how busy the server is.
	AverageLatchWaitTimems	AverageLatchWaitTimems	Milliseconds	The average latch wait time, in milliseconds, for any latch requests that had to wait. This value should generally correlate to Latch Waits/sec and move up or down with it accordingly.
	LockTimeoutsPersec	LockTimeoutsPersec	NULL	Shows the number of lock requests per second that timed out, including internal requests for NOWAIT locks. A value greater than zero might indicate that user queries are not completing. The lower this value is, the better. Ideally should be <1
	LatchWaitsPersec	LatchWaitsPersec	NULL	The number of latches in the last second that had to wait. Latches are lightweight means of holding a very transient server resource, such as an address in memory. Ideally should be < 10.
	OpenConnectionCount	OpenConnectionCount	NULL	The total number of transport connections currently open
	TaskLimitReached	TaskLimitReached	NULL	This counter reports the total number of times that a queue monitor would have started a new task, but did not because the maximum number of tasks for the queue is already running.
	TasksAbortedPersec	TasksAbortedPersec	NULL	This reports the number of activation stored procedure tasks that end with an error, or are aborted by a queue monitor for failing to receive messages.
	DataSpaceofDB	DataSpaceofDB	%	Space utilization for the Data files.
	SQLRECEIVEsPersec	SQLRECEIVEsPersec	NULL	The number of Transact-SQL RECEIVE statements processed per second.
	TransactionsPersec	TransactionsPersec	NULL	Number of transactions started for the database.
	LoginsPersec	LoginsPersec	NULL	The number of user logins per second. Any value over 2 may indicate insufficient connection pooling.
	SQLReCompilationsPersec	SQLReCompilationsPersec	NULL	Number of times, per second, that Transact-SQL. objects attempted to be executed but had to. be recompiled before completion. This number should be at or near zero, since recompiles can cause deadlocks and exclusive compile locks. This counter's value should follow in proportion to Batch Requests/sec and SQL Compilations/sec. This needs to be nil in your system as much as possible.
	BufferCacheHitRatio	BufferCacheHitRatio	%	Percentage of pages that were found in the buffer pool without having to incur a read from disk.
	NumberofDeadlocksPersec	NumberofDeadlocksPersec	NULL	Number of lock requests, per second, which resulted in a deadlock. Since only a COMMIT, ROLLBACK, or deadlock can terminate a transaction (excluding failures or errors), this is an important value to track. Excessive deadlocking indicates a table or index design error or bad application design. Use the Profiler's ability to track deadlocks.

Agent G2 - Microsoft SQL 2008 DotNet v4 - Performance Counters

Description

Template for Microsoft SQL 2008 Performance counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft SQL 2008 DotNet v4 - Performance Counters	ReceiveIPerOsPersec	ReceiveIPerOsPersec	NULL	The number of transport receives I/O per second. Note that a transport receive I/O may contain more than one message fragment.
	LockTimeoutsPersec	LockTimeoutsPersec	NULL	Shows the number of lock requests per second that timed out, including internal requests for NOWAIT locks. A value greater than zero might indicate that user queries are not completing. The lower this value is, the better. Ideally should be <1
	DataSpaceofDB	DataSpaceofDB	%	Space utilization for the Data files.
	TasksAbortedPersec	TasksAbortedPersec	NULL	This reports the number of activation stored procedure tasks that end with an error, or are aborted by a queue monitor for failing to receive messages.
	SQLSENDsPersec	SQLSENDsPersec	NULL	The number of Transact-SQL SEND statements executed per second.
	NumberofDeadlocksPersec	NumberofDeadlocksPersec	NULL	Number of lock requests, per second, which resulted in a deadlock. Since only a COMMIT, ROLLBACK, or deadlock can terminate a transaction (excluding failures or errors), this is an important value to track. Excessive deadlocking indicates a table or index design error or bad application design. Use the Profiler's ability to track deadlocks.
	LatchWaitsPersec	LatchWaitsPersec	NULL	The number of latches in the last second that had to wait. Latches are lightweight means of holding a very transient server resource, such as an address in memory. Ideally should be < 10.
	UsedLogSpace	UsedLogSpace	NULL	The cumulative used size of all the log files in the database.
	SendIPerOsPersec	SendIPerOsPersec	NULL	The number of transport send I/Os per second. Note that a transport send I/O may contain more than one message fragment.
	SQLCompilationsPersec	SQLCompilationsPersec	NULL	Number of times that Transact-SQL compilations occurred, per second (including recompiles). The lower this value is the better. High values often indicate excessive adhoc querying and should be as low as possible. If excessive adhoc querying is happening, try rewriting the queries as procedures or invoke the queries using sp_executeSQL. When rewriting isn't possible, consider using a plan guide or setting the database to parameterization forced mode.
	LogoutsPersec	LogoutsPersec	NULL	The number of user logouts per second. Any value over 2 may indicate insufficient connection pooling.
	BufferCacheHitRatio	BufferCacheHitRatio	%	Percentage of pages that were found in the buffer pool without having to incur a read from disk.
	SQLReCompilationsPersec	SQLReCompilationsPersec	NULL	Number of times, per second, that Transact-SQL. objects attempted to be executed but had to. be recompiled before completion. This number should be at or near zero, since recompiles can cause deadlocks and exclusive compile locks. This counter's value should follow in proportion to Batch Requests/sec and SQL Compilations/sec. This needs to be nil in your system as much as possible.
	TaskLimitReached	TaskLimitReached	NULL	This counter reports the total number of times that a queue monitor would have started a new task, but did not because the maximum number of tasks for the queue is already running.
	OpenConnectionCount	OpenConnectionCount	NULL	The total number of transport connections currently open
	SQLRECEIVEsPersec	SQLRECEIVEsPersec	NULL	The number of Transact-SQL RECEIVE statements processed per second.
	MSSQLCacheHitRatio	MSSQLCacheHitRatio	NULL	Ratio between cache hits and lookups.
	AverageLatchWaitTimems	AverageLatchWaitTimems	Milliseconds	The average latch wait time, in milliseconds, for any latch requests that had to wait. This value should generally correlate to Latch Waits/sec and move up or down with it accordingly.
	UserConnections	UserConnections	NULL	This shows the number of user connections, not the number of users, that are currently connected to SQL Server. A single user can have multiple connections open, and also that multiple people can share a single user connection. This indicates that how busy the server is.
	BrokerTransactionRollbacks	BrokerTransactionRollbacks	NULL	The number of rolled-back transactions that contained DML statements related to Service Broker, such as SEND and RECEIVE.
	LoginsPersec	LoginsPersec	NULL	The number of user logins per second. Any value over 2 may indicate insufficient connection pooling.
	TransactionsPersec	TransactionsPersec	NULL	Number of transactions started for the database.

Agent G2 - Microsoft SQL 2012 Advanced Performance Counters DotNet v4

Description

Microsoft SQL 2012 Advanced Performance Counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft SQL 2012 Advanced Performance Counters DotNet v4	mssql.active.transactions	MSSQL Active Transactions	NULL	Shows number of active update transactions for the database.
	mssqldb.allocated.freespace.mb	MSSQL DB Allocated Freespace MB	MB	Shows the allocated freespace for memory manager.
	mssql.stolen.server.memorykb	MSSQL Stolen Server Memory KB	NULL	Shows the amount of memory the server is currently using for purposes other than the database pages.
	mssql.transactions.per.sec	MSSQL Transactions Per Sec	NULL	Shows number of transactions started for the database.
	mssql.average.wait.timems	MSSQL Average Wait Time MS	MS	Shows the average amount of wait time (in milliseconds) for each lock request that resulted in a wait.
	mssql.page.life.expectancy	MSSQL PageLifeExpectancy	NULL	Number of seconds a page will stay in the buffer pool without references.
	mssql.db.cpu.utilization	MSSQL DB CPU Utilization	%	Shows the percentage of CPU utilization for SQL database.

Agent G2 - Microsoft SQL 2012 DotNet v4

Description

Template for Microsoft SQL 2012 counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft SQL 2012 DotNet v4	SQLSENDsPersec	SQLSENDsPersec	NULL	The number of Transact-SQL SEND statements executed per second.
	ReceiveIPerOsPersec	ReceiveIPerOsPersec	NULL	The number of transport receives I/O per second. Note that a transport receive I/O may contain more than one message fragment.
	LockWaitsPersec	LockWaitsPersec	NULL	This counter reports how many times users waited to acquire a lock over the past second. Note that while you are actually waiting on the lock, this is not reflected in this counter. It gets incremented only when you 'wake up' after waiting on the lock. If this value is nonzero, then it is an indication that there is at least some level of blocking occurring. If you combine this with the Lock Wait Time counter, you can get some idea of how long the blocking lasted. A zero value for this counter can definitively rule out blocking as a potential cause; a nonzero value will require looking at other information to determine whether it is significant.
	TaskLimitReached	TaskLimitReached	NULL	This counter reports the total number of times that a queue monitor would have started a new task, but did not because the maximum number of tasks for the queue is already running.
	MSSQLCacheHitRatio	MSSQLCacheHitRatio	NULL	Ratio between cache hits and lookups.
	SQLRECEIVEsPersec	SQLRECEIVEsPersec	NULL	The number of Transact-SQL RECEIVE statements processed per second.
	FreeMemoryKB	FreeMemoryKB	NULL	This monitor returns the amount of memory the server is currently using for the database pages cache. This monitor returns the amount of committed memory currently not used by the server.
	LongestTransactionRunningTime	LongestTransactionRunningTime	NULL	The length of time in seconds the transaction that has been running the longest has been active.
	BufferCacheHitRatio	BufferCacheHitRatio	%	Percentage of pages that were found in the buffer pool without having to incur a read from disk.
	UsedLogSpace	UsedLogSpace	NULL	The cumulative used size of all the log files in the database.
	BrokerTransactionRollbacks	BrokerTransactionRollbacks	NULL	The number of rolled-back transactions that contained DML statements related to Service Broker, such as SEND and RECEIVE.
	PagesPersec	PagesPersec	KBps	Pages/sec is the rate at which pages are read from or written to disk to resolve hard page faults. This counter is a primary indicator of the kinds of faults that cause system-wide delays. It is the sum of Memory Pages Input/sec and Memory Pages Output/sec.
	TasksAbortedPersec	TasksAbortedPersec	NULL	This reports the number of activation stored procedure tasks that end with an error, or are aborted by a queue monitor for failing to receive messages.
	DatabaseCacheMemoryKB	DatabaseCacheMemoryKB	NULL	This monitor returns the amount of memory the server is currently using for the database pages cache.
	AverageLatchWaitTimems	AverageLatchWaitTimems	Milliseconds	The average latch wait time, in milliseconds, for any latch requests that had to wait. This value should generally correlate to Latch Waits/sec and move up or down with it accordingly.
	NumberofDeadlocksPersec	NumberofDeadlocksPersec	NULL	Number of lock requests, per second, which resulted in a deadlock. Since only a COMMIT, ROLLBACK, or deadlock can terminate a transaction (excluding failures or errors), this is an important value to track. Excessive deadlocking indicates a table or index design error or bad application design. Use the Profiler's ability to track deadlocks.
	UserConnections	UserConnections	NULL	This shows the number of user connections, not the number of users, that are currently connected to SQL Server. A single user can have multiple connections open, and also that multiple people can share a single user connection. This indicates that how busy the server is.
	LockTimeoutsPersec	LockTimeoutsPersec	NULL	Shows the number of lock requests per second that timed out, including internal requests for NOWAIT locks. A value greater than zero might indicate that user queries are not completing. The lower this value is, the better. Ideally should be <1
	OptimizerMemoryKB	OptimizerMemoryKB	NULL	This monitor returns the total amount of dynamic memory the server is using for query optimization.
	OpenConnectionCount	OpenConnectionCount	NULL	The total number of transport connections currently open
	LoginsPersec	LoginsPersec	NULL	The number of user logins per second. Any value over 2 may indicate insufficient connection pooling.
	LogoutsPersec	LogoutsPersec	NULL	The number of user logouts per second. Any value over 2 may indicate insufficient connection pooling.
	SQLReCompilationsPersec	SQLReCompilationsPersec	NULL	Number of times, per second, that Transact-SQL. objects attempted to be executed but had to. be recompiled before completion. This number should be at or near zero, since recompiles can cause deadlocks and exclusive compile locks. This counter's value should follow in proportion to Batch Requests/sec and SQL Compilations/sec. This needs to be nil in your system as much as possible.
	TransactionsPersec	TransactionsPersec	NULL	Number of transactions started for the database.
	SQLCompilationsPersec	SQLCompilationsPersec	NULL	Number of times that Transact-SQL compilations occurred, per second (including recompiles). The lower this value is the better. High values often indicate excessive adhoc querying and should be as low as possible. If excessive adhoc querying is happening, try rewriting the queries as procedures or invoke the queries using sp_executeSQL. When rewriting isn't possible, consider using a plan guide or setting the database to parameterization forced mode.
	DataSpaceofDB	DataSpaceofDB	%	Space utilization for the Data files.
	SendIPerOsPersec	SendIPerOsPersec	NULL	The number of transport send I/Os per second. Note that a transport send I/O may contain more than one message fragment.
	LatchWaitsPersec	LatchWaitsPersec	NULL	The number of latches in the last second that had to wait. Latches are lightweight means of holding a very transient server resource, such as an address in memory. Ideally should be < 10.
	TotalServerMemoryKB	TotalServerMemoryKB	KB	The Total Server Memory is the current amount of memory that SQL Server is using. If this counter is still growing, the server has not yet reached its steady-state, and it is still trying to populate the cache and get pages loaded into memory. Performance will likely be somewhat slower during this time, since more disk I/O is required at this stage. This behavior is normal. Eventually Total Server Memory should approximate Target Server Memory.

Agent G2 - Microsoft SQL 2012 DotNet v4 - Performance Counters

Description

Template for Microsoft SQL 2012 Performance counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft SQL 2012 DotNet v4 - Performance Counters	mssql2012.page.splits.per.sec	MSSQL2012 Page Splits Per Second	NULL	Number of page splits per second that occur as a result of overflowing index pages.
	mssql2012.free.list.stalls.per.sec	MSSQL2012 Free List Stalls Per Second	NULL	Number of requests that had to wait for a free page.
	mssql2012.probe.scans.per.sec	MSSQL2012 Probe Scans Per Second	NULL	Number of probe scans per second that are used to find at most one single qualified row in an index or base table directly.
	mssql2012.batch.requests.per.sec	MSSQL2012 Batch Requests Per Second	NULL	Number of SQL batch requests received by server.
	mssql2012.forwarded.records.per.sec	MSSQL2012 Forwarded Records Per Second	NULL	Number of records fetched through forwarded record pointers.
	mssql2012.failed.auto.params.per.sec	MSSQL2012 Failed Auto Params Per Second	NULL	Number of failed auto-parameterizations.
	mssql2012.full.scans.per.sec	MSSQL2012 Full Scans Per Second	NULL	Number of unrestricted full scans. These can either be base table or full index scans.
	mssql2012.database.pages	MSSQL2012 Database Pages	NULL	Number of pages in the buffer pool with database content.
	mssql2012.cache.object.counts	MSSQL2012 Cache Object Counts	NULL	Number of cache objects in the cache.
	mssql2012.worktables.created.per.sec	MSSQL2012 Worktables Created Per Second	NULL	Number of work tables created per second. For example, work tables could be used to store temporary results for query spool, LOB variables, XML variables, and cursors.
	mssql2012.granted.workspace.memory.kb	MSSQL2012 Granted Workspace Memory KB	KB	Total amount of memory granted to executing processes. This memory is used for hash, sort and create index operations.
	mssql2012.page.reads.per.sec	MSSQL2012 Page Reads Per Second	NULL	Number of physical database page reads issued.
	mssql2012.lock.requests.per.sec	MSSQL2012 Lock Requests Per Second	NULL	Number of new locks and lock conversions requested from the lock manager.
	mssql2012.auto.param.attempts.per.sec	MSSQL2012 Auto Param Attempts Per Second	NULL	Number of auto-parameterization attempts.
	mssql2012.range.scans.per.sec	MSSQL2012 Range Scans Per Second	NULL	Number of qualified range scans through indexes per second.
	mssql2012.workfiles.created.per.sec	MSSQL2012 Workfiles Created Per Second	NULL	Number of work files created per second. For example, work files could be used to store temporary results for hash joins and hash aggregates.
	mssql2012.cache.objects.in.use	MSSQL2012 Cache Objects in use	NULL	Number of cache objects in use.
	mssql2012.lock.wait.time.ms	MSSQL2012 Lock Wait Time MS	MS	Total wait time (milliseconds) for locks in the last second.
	mssql2012.page.writes.per.sec	MSSQL2012 Page Writes Per Second	NULL	Number of physical database page writes issued.
	mssql2012.target.server.memory.kb	MSSQL2012 Target Server Memory KB	KB	Ideal amount of memory the server is willing to consume.

Agent G2 - Microsoft SQL 2012 Query DotNet v4

Description

Monitors MSSQL 2012 query based monitoring.

Prerequisites

Prepare a file ““SQLCred.txt”” with content in the below format and place the text file in “\Agent\conf”. username – sa password – sa server – localhost

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft SQL 2012 Query DotNet v4	SQLCompilationPercentage	SQLCompilationPercentage	NULL	Shows the current percentage of compilations to the number of batch requests.
	IdentifyDatabaseblockings	IdentifyDatabaseblockings	NULL	Displays the blocked processes count.
	AverageTaskCounts	AverageTaskCounts	NULL	Shows the average of current tasks count.
	NumberOfConnectionsToTheSQLServerInstance	NumberOfConnectionsToTheSQLServerInstance	NULL	Displays the number of connections established to the SQL Server Instance.
	PageLookupsPercentage	PageLookupsPercentage	NULL	Shows the average number of requests to find a page in the buffer.
	SignalWaitsPercentage	SignalWaitsPercentage	NULL	Shows the average wait time a session id spends waiting for the CPU to become available to run it.
	BufferPoolIORate	BufferPoolIORate	NULL	Shows the rate at which data pages are being cycled in the buffer pool.
	Reqeuestprocessed	Reqeuestprocessed	NULL	Shows the requests processed count.

Agent G2 - Microsoft SQL 2012 WMI DotNet v4 - Performance Counters

Description

Template for Microsoft SQL 2012 WMI quries performance counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft SQL 2012 WMI DotNet v4 - Performance Counters	UserConnections	UserConnections	NULL	This shows the number of user connections, not the number of users, that are currently connected to SQL Server. A single user can have multiple connections open, and also that multiple people can share a single user connection. This indicates that how busy the server is.
	LockMemoryKB	LockMemoryKB	NULL	This monitor returns the total amount of dynamic memory the server is using for locks.
	LogFilesSizeKB	LogFilesSizeKB	NULL	The total size of the database log files.
	OptimizerMemoryKB	OptimizerMemoryKB	NULL	This monitor returns the total amount of dynamic memory the server is using for query optimization.
	PagewritesPersec	PagewritesPersec	NULL	Page Writes/sec is the rate at which pages are written to disk to free up space in physical memory. Pages are written to disk only if they are changed while in physical memory, so they are likely to hold data, not code. This counter shows write operations, without regard to the number of pages written in each operation. This counter displays the difference between the values observed in the last two samples, divided by the duration of the sample interval.
	LockTimeoutsPersec	LockTimeoutsPersec	NULL	Shows the number of lock requests per second that timed out, including internal requests for NOWAIT locks. A value greater than zero might indicate that user queries are not completing. The lower this value is, the better. Ideally should be <1
	Pagelifeexpectancy	Pagelifeexpectancy	NULL	This performance monitor counter tells you, on average, how long data pages are staying in the buffer. If this value gets below 300 seconds, this is a potential indication that your SQL Server could use more memory in order to boost performance.
	LoginsPersec	LoginsPersec	NULL	The number of user logins per second. Any value over 2 may indicate insufficient connection pooling.
	PagesPersec	PagesPersec	KBps	Pages/sec is the rate at which pages are read from or written to disk to resolve hard page faults. This counter is a primary indicator of the kinds of faults that cause system-wide delays. It is the sum of Memory Pages Input/sec and Memory Pages Output/sec.
	LockWaitsPersec	LockWaitsPersec	NULL	This counter reports how many times users waited to acquire a lock over the past second. Note that while you are actually waiting on the lock, this is not reflected in this counter. It gets incremented only when you 'wake up' after waiting on the lock. If this value is nonzero, then it is an indication that there is at least some level of blocking occurring. If you combine this with the Lock Wait Time counter, you can get some idea of how long the blocking lasted. A zero value for this counter can definitively rule out blocking as a potential cause; a nonzero value will require looking at other information to determine whether it is significant.
	LazyWritesPerSec	LazyWritesPerSec	NULL	This is the number of times per second lazy writer has to flush dirty pages out of the buffer cache instead of waiting on a checkpoint. Typically dirty pages are flushed out of cache by the checkpoint process. If the value of this counter is higher than 20, then the server could use additional RAM.
	QueueLength	QueueLength	NULL	Queue Length is the current length of the server work queue for this CPU. A sustained queue length greater than twice the number of CPU cores might indicate processor congestion
	TransactionsPersec	TransactionsPersec	NULL	Number of transactions started for the database.
	AvgDiskWriteQueueLength	AvgDiskWriteQueueLength	NULL	Average Disk Write Queue Length is the average number of write requests that were queued for the selected disk during the sample interval. The value for this counter should always be under 2. This is the most reliable counter to use when the SQL instance is using external SAN storage for its databases.
	SQLCacheMemoryKB	SQLCacheMemoryKB	NULL	This monitor returns the total amount of dynamic memory the server is using for the dynamic SQL cache.
	FreeMemoryKB	FreeMemoryKB	NULL	This monitor returns the amount of memory the server is currently using for the database pages cache. This monitor returns the amount of committed memory currently not used by the server.
	NumberofDeadlocksPersec	NumberofDeadlocksPersec	NULL	Number of lock requests, per second, which resulted in a deadlock. Since only a COMMIT, ROLLBACK, or deadlock can terminate a transaction (excluding failures or errors), this is an important value to track. Excessive deadlocking indicates a table or index design error or bad application design. Use the Profiler's ability to track deadlocks.
	PagereadsPersec	PagereadsPersec	NULL	The number of physical database page reads issued. 80 to 90 per second is normal, anything that is above indicates indexing or memory constraint. Values for this counter will vary between database applications, but this information is useful when determining if SQL Server is the primary application using the disk. If the Buffer Manager page read-writes are low but disk-queue lengths are high, there might be a disk bottleneck. If the Page read-writes are higher than normal, a memory shortage is likely to exist.
	MemoryGrantsPending	MemoryGrantsPending	NULL	Total number of processes waiting to acquire a workspace memory grant.
	DataFilesSizeKB	DataFilesSizeKB	NULL	The total size of the database data files.
	LatchWaitsPersec	LatchWaitsPersec	NULL	The number of latches in the last second that had to wait. Latches are lightweight means of holding a very transient server resource, such as an address in memory. Ideally should be < 10.
	ConnectionMemoryKB	ConnectionMemoryKB	NULL	This monitor returns the total amount of dynamic memory the server is using for maintaining connections.
	SQLCompilationsPersec	SQLCompilationsPersec	NULL	Number of times that Transact-SQL compilations occurred, per second (including recompiles). The lower this value is the better. High values often indicate excessive adhoc querying and should be as low as possible. If excessive adhoc querying is happening, try rewriting the queries as procedures or invoke the queries using sp_executeSQL. When rewriting isn't possible, consider using a plan guide or setting the database to parameterization forced mode.
	AverageWaitTimems	AverageWaitTimems	NULL	The average wait time in milliseconds of each lock request that had a wait time.
	LogFlushesPersec	LogFlushesPersec	NULL	The total number of log bytes flushed.
	TotalServerMemoryKB	TotalServerMemoryKB	KB	The Total Server Memory is the current amount of memory that SQL Server is using. If this counter is still growing, the server has not yet reached its steady-state, and it is still trying to populate the cache and get pages loaded into memory. Performance will likely be somewhat slower during this time, since more disk I/O is required at this stage. This behavior is normal. Eventually Total Server Memory should approximate Target Server Memory.
	AvgDiskReadQueueLength	AvgDiskReadQueueLength	NULL	Average Disk Read Queue Length is the average number of read requests that were queued for the selected disk during the sample interval. The value for this counter should always be under 2. This is the most reliable counter to use when the SQL instance is using external SAN storage for its databases.
	LongestTransactionRunningTime	LongestTransactionRunningTime	NULL	The length of time in seconds the transaction that has been running the longest has been active.
	FullScansPersec	FullScansPersec	NULL
	BufferCacheHitRatio	BufferCacheHitRatio	%	Percentage of pages that were found in the buffer pool without having to incur a read from disk.
	BatchRequestsPersec	BatchRequestsPersec	NULL	This counter measures the number of batch requests that SQL Server receives per second, and generally follows in step to how busy your server's CPUs are. Generally speaking, over 1000 batch requests per second indicates a very busy SQL Server, and could mean that if you are not already experiencing a CPU bottleneck, that you may be experiencing one soon. Of course, this is a relative number, and the bigger your hardware, the more batch requests per second SQL Server can handle.
	DatabaseCacheMemoryKB	DatabaseCacheMemoryKB	NULL	This monitor returns the amount of memory the server is currently using for the database pages cache.

Agent G2 - Microsoft SQL 2014 DotNet v4 - Performance Counters

Description

Template for Microsoft SQL 2014 Performance counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft SQL 2014 DotNet v4 - Performance Counters	mssql2014.locktimeouts.per.sec	Lock Timeouts Per Sec	NULL	Shows the number of lock requests that timed out. This includes requests for NOWAIT locks.
	mssql2014.sqlreceives.per.sec	SQL Receives Per Sec	NULL	Shows the number of SQL RECEIVE commands processed by the Broker per second.
	mssql2014.logfiles.usedsize.kb	Log Files Used Size KB	NULL	Shows the cumulative used size of all the log files in the database.
	mssql2014.buffercache.hit.ratio	Buffer Cache Hit Ratio	%	Shows the Percentage of pages that were found in the buffer pool without having to incur a read from disk.
	mssql2014.sqlrecompilations.per.sec	SQL ReCompilations Per Sec	NULL	Shows the number of SQL re-compiles.
	mssql2014.user.connections	User Connections	NULL	Shows the number of users connected to the system.
	mssql2014.datafilessize.kb	Data Files Size KB	NULL	Shows the cumulative size of all the data files in the database.
	mssql2014.sqlcompilations.per.sec	SQL Compilations Per Sec	NULL	Shows the number of SQL compilations.
	mssql2014.broker.transaction.rollbacks	Broker Tranasaction Roll Backs	NULL	Shows the number of Service Broker related transactions that have rolled back.
	mssql2014.sqlsends.per.sec	SQL Sends Per Sec	NULL	Shows the number of SQL SEND commands processed by the Broker per second.
	mssql2014.cachehit.ratio	Cache Hit Ratio	NULL	Shows the ratio between cache hits and lookups
	mssql2014.logouts.per.sec	Logouts Per Sec	NULL	Shows the total number of logouts started per second.
	mssql2014.numberofdeadlocks.per.sec	Number of Deadlocks Per Sec	NULL	Shows the number of lock requests that resulted in a deadlock.
	mssql2014.tasksaborted.per.sec	Task Aborted Per Sec	NULL	Shows the number of activated tasks that are being aborted per second.
	mssql2014.transactions.per.sec	Transactions Per Sec	NULL	Shows the number of transactions started for the database.
	mssql2014.tasklimit.reached	Task Limit Reached	NULL	Shows the total number of times the activated task limit on a queue has been reached.
	mssql2014.logins.per.sec	Logins Per Sec	NULL	Shows the total number of logins started per second.
	mssql2014.latchwaits.per.sec	Latch Waits Per Sec	NULL	Shows the number of latch requests that could not be granted immediately and had to wait before being granted.
	mssql2014.open.connection.count	Open Connection Count	NULL	Shows the total number of transport connections currently open.
	mssql2014.sendiperos.per.sec	Send IO Per Sec	NULL	Shows the number of transport send I/Os per second. Note that a transport send I/O may contain more than one message fragment.
	mssql2014.average.latchwait.timems	Average Latch Wait Time in MS	NULL	Shows the Average latch wait time (milliseconds) for latch requests that had to wait.
	mssql2014.receiveiperos.per.sec	Receive IO Per Sec	NULL	Shows the number of transport receives I/O per second. Note that a transport receive I/O may contain more than one message fragment.

Agent G2 - Microsoft SQL 2016 - Performance Counters DotNet v4

Description

Template for Microsoft SQL 2016 Performance counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft SQL 2016 - Performance Counters DotNet v4	mssql2016.latchwaits.per.sec	MSSQL2016 Latch Waits Per Sec	NULL	Shows the number of latch requests that could not be granted immediately and had to wait before being granted.
	mssql2016.numberofdeadlocks.per.sec	MSSQL2016 Number of Deadlocks Per Sec	NULL	Shows the number of lock requests that resulted in a deadlock.
	mssql2016.buffercache.hit.ratio	MSSQL2016 Buffer Cache Hit Ratio	%	Shows the Percentage of pages that were found in the buffer pool without having to incur a read from disk.
	mssql2016.sqlsends.per.sec	MSSQL2016 SQL Sends Per Sec	NULL	Shows the number of SQL SEND commands processed by the Broker per second.
	mssql2016.sqlrecompilations.per.sec	MSSQL2016 SQL ReCompilations Per Sec	NULL	Shows the number of SQL re-compiles.
	mssql2016.tasklimit.reached	MSSQL2016 Task Limit Reached	NULL	Shows the total number of times the activated task limit on a queue has been reached.
	mssql2016.sqlcompilations.per.sec	MSSQL2016 SQL Compilations Per Sec	NULL	Shows the number of SQL compilations.
	mssql2016.sqlreceives.per.sec	MSSQL2016 SQL Receives Per Sec	NULL	Shows the number of SQL RECEIVE commands processed by the Broker per second.
	mssql2016.locktimeouts.per.sec	MSSQL2016 Lock Timeouts Per Sec	NULL	Shows the number of lock requests that timed out. This includes requests for NOWAIT locks.
	mssql2016.sendiperos.per.sec	MSSQL2016 Send IO Per Sec	NULL	Shows the number of transport send I/O per second. Note that a transport send I/O may contain more than one message fragment.
	mssql2016.logouts.per.sec	MSSQL2016 Logouts Per Sec	NULL	Shows the total number of logouts started per second.
	mssql2016.broker.transaction.rollbacks	MSSQL2016 Broker Tranasaction Roll Backs	NULL	Shows the number of Service Broker related transactions that have rolled back.
	mssql2016.cachehit.ratio	MSSQL2016 Cache Hit Ratio	NULL	Shows the ratio between cache hits and lookups
	mssql2016.average.latchwait.timems	MSSQL2016 Average Latch Wait Time in MS	NULL	Shows the Average latch wait time (milliseconds) for latch requests that had to wait.
	mssql2016.transactions.per.sec	MSSQL2016 Transactions Per Sec	NULL	Shows the number of transactions started for the database.
	mssql2016.logins.per.sec	MSSQL2016 Logins Per Sec	NULL	Shows the total number of logins started per second.
	mssql2016.open.connection.count	MSSQL2016 Open Connection Count	NULL	Shows the total number of transport connections currently open.
	mssql2016.tasksaborted.per.sec	MSSQL2016 Task Aborted Per Sec	NULL	Shows the number of activated tasks that are being aborted per second.
	mssql2016.datafilessize.kb	MSSQL2016 Data Files Size KB	NULL	Shows the cumulative size of all the data files in the database.
	mssql2016.logfiles.usedsize.kb	MSSQL2016 Log Files Used Size KB	NULL	Shows the cumulative used size of all the log files in the database.
	mssql2016.user.connections	MSSQL2016 User Connections	NULL	Shows the number of users connected to the system.
	mssql2016.receiveiperos.per.sec	MSSQL2016 Receive IO Per Sec	NULL	Shows the number of transport receives I/O per second. Note that a transport receive I/O may contain more than one message fragment.

Agent G2 - Microsoft SQL 2019 DotNet v4

Description

Monitors Microsoft SQL 2019 metrics LatchWaitsPersec, AverageLatchWaitTimems, DataFilesSizeKB, LogFilesUsedSizeKB, LockTimeoutsPersec, NumberofDeadlocksPersec, Buffercachehitratio, Pagelifeexpectancy, PhysicalDiskAvgDisksecPerRead, PhysicalDiskAvgDisksecPerWrite

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft SQL 2019 DotNet v4	mssql2019.datafilesizekb	MSSQL2019 DataFilesSizeKB	KB	Shows the cumulative size of all the data files in the database.
	mssql2019.physicaldisk.avgdisksecperread	MSSQL2019 PhysicalDisk AvgDisksecPerRead	NULL	Avg. Disk sec/Read is the average time, in seconds, of a read of data from the disk.
	mssql2019.locktimeoutspersec	MSSQL2019 LockTimeoutsPersec	Count	Shows the number of lock requests that timed out. This includes requests for NOWAIT locks.
	mssql2019.averagelatchwaittimems	MSSQL2019 AverageLatchWaitTimems	Milliseconds	Shows the Average latch wait time (milliseconds) for latch requests that had to wait.
	mssql2019.pagelifeexpectancy	MSSQL2019 Pagelifeexpectancy	NULL	Number of seconds a page will stay in the buffer pool without references.
	mssql2019.physicaldisk.avgdisksecperwrite	MSSQL2019 PhysicalDisk AvgDisksecPerWrite	NULL	Avg. Disk sec/Write is the average time, in seconds, of a write of data to the disk.
	mssql2019.buffercachehitratio	MSSQL2019 Buffercachehitratio	%	Shows the Percentage of pages that were found in the buffer pool without having to incur a read from disk.
	mssql2019.latchwaitspersec	MSSQL2019 LatchWaitsPersec	Count	Shows the number of latch requests that could not be granted immediately and had to wait before being granted.
	mssql2019.numberofdeadlockspersec	MSSQL2019 NumberofDeadlocksPersec	Count	Shows the number of lock requests that resulted in a deadlock.
	mssql2019.logfilesusedsizekb	MSSQL2019 LogFilesUsedSizeKB	KB	Shows the cumulative used size of all the log files in the database.

Agent G2 - Microsoft SQL Performance Counters DotNet v4

Description

Microsoft SQL Server Performance Counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft SQL Performance Counters DotNet v4	logicaldisk.average.disk.write.queue.length	LogicalDisk AverageDiskWriteQueueLength	NULL	Avg. Disk Write Queue Length is the average number of write requests that were queued for the selected disk during the sample interval.
	logicaldisk.average.disk.read.queue.length	LogicalDisk AverageDiskReadQueueLength	NULL	Avg. Disk Read Queue Length is the average number of read requests that were queued for the selected disk during the sample interval.
	mssql.serverworkqueue.queuelength	MSSQL ServerWorkQueueQueueLength	NULL	Current length of the server work queue for this CPU. A sustained queue length greater than four might indicate processor congestion. This is an instantaneous count, not an average over time.
	memory.pages.per.sec	Memory PagesPerSec	NULL	Pages/sec is the rate at which pages are read from or written to disk to resolve hard page faults. This counter is a primary indicator of the kinds of faults that cause system-wide delays. It is the sum of Memory\\Pages Input/sec and Memory\\Pages Output.

Agent G2 - Microsoft SQL Server 2016 DotNet v4 - Performance Counters

Description

Template for Microsoft SQL 2016 Performance counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft SQL Server 2016 DotNet v4 - Performance Counters	mssql2016.logfiles.usedsize.kb	MSSQL2016 Log Files Used Size KB	NULL	Shows the cumulative used size of all the log files in the database.
	mssql2016.user.connections	MSSQL2016 User Connections	NULL	Shows the number of users connected to the system.
	mssql2016.cachehit.ratio	MSSQL2016 Cache Hit Ratio	NULL	Shows the ratio between cache hits and lookups.
	mssql2016.latchwaits.per.sec	MSSQL2016 Latch Waits Per Sec	NULL	Shows the number of latch requests that could not be granted immediately and had to wait before being granted.
	mssql2016.open.connection.count	MSSQL2016 Open Connection Count	NULL	Shows the total number of transport connections currently open.
	mssql2016.logins.per.sec	MSSQL2016 Logins Per Sec	NULL	Shows the total number of logins started per second.
	mssql2016.sqlsends.per.sec	MSSQL2016 SQL Sends Per Sec	NULL	Shows the number of SQL SEND commands processed by the Broker per second.
	mssql2016.receiveiperos.per.sec	MSSQL2016 Receive IO Per Sec	NULL	Shows the number of transport receives I/O per second. Note that a transport receive I/O may contain more than one message fragment.
	mssql2016.broker.transaction.rollbacks	MSSQL2016 Broker Tranasaction Roll Backs	NULL	Shows the number of Service Broker related transactions that have rolled back.
	mssql2016.sqlcompilations.per.sec	MSSQL2016 SQL Compilations Per Sec	NULL	Shows the number of SQL compilations.
	mssql2016.locktimeouts.per.sec	MSSQL2016 Lock Timeouts Per Sec	NULL	Shows the number of lock requests that timed out. This includes requests for NOWAIT locks.
	mssql2016.numberofdeadlocks.per.sec	MSSQL2016 Number of Deadlocks Per Sec	NULL	Shows the number of lock requests that resulted in a deadlock.
	mssql2016.tasksaborted.per.sec	MSSQL2016 Task Aborted Per Sec	NULL	Shows the number of activated tasks that are being aborted per second.
	mssql2016.tasklimit.reached	MSSQL2016 Task Limit Reached	NULL	Shows the total number of times the activated task limit on a queue has been reached.
	mssql2016.datafilessize.kb	MSSQL2016 Data Files Size KB	NULL	Shows the cumulative size of all the data files in the database.
	mssql2016.average.latchwait.timems	MSSQL2016 Average Latch Wait Time in MS	NULL	Shows the Average latch wait time (milliseconds) for latch requests that had to wait.
	mssql2016.sqlrecompilations.per.sec	MSSQL2016 SQL ReCompilations Per Sec	NULL	Shows the number of SQL re-compiles.
	mssql2016.buffercache.hit.ratio	MSSQL2016 Buffer Cache Hit Ratio	%	Shows the Percentage of pages that were found in the buffer pool without having to incur a read from disk.
	mssql2016.transactions.per.sec	MSSQL2016 Transactions Per Sec	NULL	Shows the number of transactions started for the database.
	mssql2016.sqlreceives.per.sec	MSSQL2016 SQL Receives Per Sec	NULL	Shows the number of SQL RECEIVE commands processed by the Broker per second.
	mssql2016.logouts.per.sec	MSSQL2016 Logouts Per Sec	NULL	Shows the total number of logouts started per second.
	mssql2016.sendiperos.per.sec	MSSQL2016 Send IO Per Sec	NULL	Shows the number of transport send I/O per second. Note that a transport send I/O may contain more than one message fragment.

Agent G2 - Microsoft SQL Server 2017 DotNet v4 - Performance Counters

Description

Microsoft SQL Server 2017 Performance Counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft SQL Server 2017 DotNet v4 - Performance Counters	mssql2017.latchwaitspersec	MSSQL2017 LatchWaitsPersec	NULL	Shows the number of latch requests that could not be granted immediately and had to wait before being granted.
	mssql2017.averagelatchwaittimems	MSSQL2017 AverageLatchWaitTimems	NULL	Shows the Average latch wait time (milliseconds) for latch requests that had to wait.
	mssql2017.physicaldisk.avgdisksecperwrite	MSSQL2017 PhysicalDisk AvgDisksecPerWrite	NULL	Avg. Disk sec/Write is the average time, in seconds, of a write of data to the disk.
	mssql2017.logfilesusedsizekb	MSSQL2017 LogFilesUsedSizeKB	NULL	Shows the cumulative used size of all the log files in the database.
	mssql2017.buffercachehitratio	MSSQL2017 Buffercachehitratio	%	Shows the Percentage of pages that were found in the buffer pool without having to incur a read from disk.
	mssql2017.locktimeoutspersec	MSSQL2017 LockTimeoutsPersec	NULL	Shows the number of lock requests that timed out. This includes requests for NOWAIT locks.
	mssql2017.pagelifeexpectancy	MSSQL2017 Pagelifeexpectancy	NULL	Number of seconds a page will stay in the buffer pool without references.
	mssql2017.datafilesizekb	MSSQL2017 DataFilesSizeKB	NULL	Shows the cumulative size of all the data files in the database.
	mssql2017.physicaldisk.avgdisksecperread	MSSQL2017 PhysicalDisk AvgDisksecPerRead	NULL	Avg. Disk sec/Read is the average time, in seconds, of a read of data from the disk.
	mssql2017.numberofdeadlockspersec	MSSQL2017 NumberofDeadlocksPersec	NULL	Shows the number of lock requests that resulted in a deadlock.

Agent G2 - Microsoft Terminal Services Performance Counters DotNet v4

Description

Monitors windows Terminal Services Performance data

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Terminal Services Performance Counters DotNet v4	ActiveSessions	ActiveSessions	NULL	The number of Desktop sessions currently streamed
	PrivateBytes	PrivateBytes	NULL	Private Bytes is the current size, in bytes, of memory that this process has allocated that cannot be shared with other processes.
	TotalTransportErrors	TotalTransportErrors	NULL	Total number of Terminal Services transport-level errors.
	TotalTimeouts	TotalTimeouts	NULL	The total number of timeouts on the communication line from both the host and client sides of the connection. These are typically the result of a noisy line. On some high latency networks, this could be the result of the protocol timeout being too short. Increasing the protocol timeout on these types of lines will improve performance by reducing needless re-transmissions.
	InactiveSessions	InactiveSessions	NULL	Number of inactive Terminal Services sessions.
	TotalErrors	TotalErrors	NULL	Total number of errors of all types. Some example errors are lost ACK's, badly formed packets, etc.
	PercentProcessorTime	PercentProcessorTime	%	% Processor Time is the percentage of elapsed time that all of process threads used the processor to execution instructions. An instruction is the basic unit of execution in a computer, a thread is the object that executes instructions, and a process is the object created when a program is run. Code executed to handle some hardware interrupts and trap conditions are included in this count.
	TotalSessions	TotalSessions	Count	Total number Terminal services sessions.
	OutputErrors	OutputErrors	NULL	Number of output errors of all types. Some example output errors are lost ACK's, badly formed packets, etc.

Agent G2 - Microsoft Windows ASPNET Performance Counters

Description

Microsoft Windows ASPNET Performance Counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Windows ASPNET Performance Counters	microsoft_windows_ASPNET_WorkerProcessRestarts	Microsoft Windows ASPNET WorkerProcessRestarts	count	Number of times a worker process has restarted on the machine
	microsoft_windows_ASPNETApplications_CacheTotalHitRatio	Microsoft Windows ASPNETApplications CacheTotalHitRatio	NULL	Ratio of hits from all cache calls.
	microsoft_windows_ASPNET_ApplicationRestarts	Microsoft Windows ASPNET ApplicationRestarts	count	Number of times the application has been restarted during the web server's lifetime.
	microsoft_windows_ASPNETAppsv2050727_RequestsPersec	Microsoft Windows ASPNETAppsv2050727 RequestsPersec	count	The number of requests executed per second.

Agent G2 - Microsoft Windows Basic Performance Counters - RSE

Description

Microsoft Windows Basic Performance Counters - RSE

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Windows Basic Performance Counters - RSE	microsoft_windows_Synchronization_ExecResourceAcquiresAcqExclLitePersec	Microsoft Windows Synchronization ExecResourceAcquiresAcqExclLitePersec	NULL	Frequency of first exclusive acquires from ExAcquireResourceExclusiveLite.
	microsoft_windows_Server_WorkItemShortages	Microsoft Windows Server WorkItemShortages	count	The number of times STATUS_DATA_NOT_ACCEPTED was returned at receive indication time. This occurs when no work item is available or can be allocated to service the incoming request. Indicates whether the InitWorkItems or MaxWorkItems parameters might need to be adjusted.
	microsoft_windows_DotNETCLRMemory_FinalizationSurvivors	Microsoft Windows DotNETCLRMemory FinalizationSurvivors	count	This counter displays the number of garbage collected objects that survive a collection because they are waiting to be finalized. If these objects hold references to other objects then those objects also survive but are not counted by this counter; the "Promoted Finalization-Memory from Gen 0" and "Promoted Finalization-Memory from Gen 1" counters represent all the memory that survived due to finalization. This counter is not a cumulative counter; its updated at the end of every GC with count of the survivors during that particular GC only. This counter was designed to indicate the extra overhead that the application might incur because of finalization.
	microsoft_windows_WSManQuotaStatistics_ActiveOperations	Microsoft Windows WSManQuotaStatistics ActiveOperations	count	Displays the current number of active operations for all users.
	microsoft_windows_MSDTCBridge4000_AverageParticipantCommitResponseTime	Microsoft Windows MSDTCBridge4000 AverageParticipantCommitResponseTime	ms	Average time in milliseconds for the WS-AT service to receive a Commit message response from a participant.
	microsoft_windows_SMSvcHost4000_ConnectionsAcceptedOverNetPipe	Microsoft Windows SMSvcHost4000 ConnectionsAcceptedOverNetPipe	count	The total number of named pipe connections accepted over net.pipe.
	microsoft_windows_Redirector_ServerSessionsHung	Microsoft Windows Redirector ServerSessionsHung	count	Server Sessions Hung counts the number of active sessions that are timed out and unable to proceed due to a lack of response from the remote server.

Agent G2 - Microsoft Windows HTTP Service Counters

Description

Microsoft Windows HTTP Service Counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Windows HTTP Service Counters	microsoft_windows_HTTPServiceRequestQueues_ArrivalRate	Microsoft Windows HTTPServiceRequestQueues ArrivalRate	NULL	Rate at which requests are arriving in the queue
Agent G2 - Microsoft Windows HTTP Service Counters	microsoft_windows_HTTPServiceUrlGroups_AllRequests	Microsoft Windows HTTPServiceUrlGroups AllRequests	count	Total number of HTTP requests made for this site

Agent G2 - Microsoft Windows IPsec Performance Counters

Description

Microsoft Windows IPsec Performance Counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Windows IPsec Performance Counters	microsoft_windows_IPsecIKEv2IPv4_ActiveMainModeSAs	Microsoft Windows IPsecIKEv2IPv4 ActiveMainModeSAs	count	Active Main Mode SAs is the number of currently active main mode security associations.
	microsoft_windows_IPsecIKEv2IPv6_ActiveMainModeSAs	Microsoft Windows IPsecIKEv2IPv6 ActiveMainModeSAs	count	Active Main Mode SAs is the number of currently active main mode security associations.
	microsoft_windows_IPsecIKEv1IPv4_ActiveMainModeSAs	Microsoft Windows IPsecIKEv1IPv4 ActiveMainModeSAs	count	Active Main Mode SAs is the number of currently active main mode security associations.
	microsoft_windows_IPsecDriver_ActiveSecurityAssociations	Microsoft Windows IPsecDriver ActiveSecurityAssociations	count	Active Security Associations is the number of active quick mode security associations.
	microsoft_windows_IPsecAuthIPIPv6_ActiveExtendedModeSAs	Microsoft Windows IPsecAuthIPIPv6 ActiveExtendedModeSAs	count	Active Extended Mode SAs is the number of currently active extended mode security associations.
	microsoft_windows_IPsecDoSProtection_CurrentStateEntries	Microsoft Windows IPsecDoSProtection CurrentStateEntries	count	Current State Entries is the number of state entries in the table. A state entry is a pair of IPv6 addresses that is authorized to pass through from a public to an internal interface.

Agent G2 - Microsoft Windows LogicalDisk Defragmentation

Description

To monitor LogicalDisk Defragmentation

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
System Windows LogicalDisk Defragmentation Monitor	system_windows_logicaldisk_AverageFragmentsPerFile	System Windows LogicalDisk Average Fragments PerFile	count	Average number of fragments per file on a volume.
	system_windows_logicaldisk_TotalPercentFragmentation	System Windows LogicalDisk TotalPercent Fragmentation	%	Percent of the volume that is fragmented
	system_windows_logicaldisk_TotalFragmentedFiles	System Windows LogicalDisk Total Fragmented Files	count	Number of fragmented files on a volume.
	system_windows_logicaldisk_ExcessFolderFragments	System Windows LogicalDisk Excess FolderFragments	count	Number of excess folder fragments on a volume.
	system_windows_logicaldisk_FragmentedFolders	System Windows LogicalDisk FragmentedFolders	count	Number of fragmented folders (subdirectories) on a volume.

Agent G2 - Microsoft Windows Lsa counters

Description

Microsoft Windows Lsa counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Windows Lsa counters	microsoft_windows__Lsa_SecuritySystemWideStatistics_ActiveSchannelSessionCacheEntries	Microsoft Windows Lsa SecuritySystemWideStatistics ActiveSchannelSessionCacheEntries	count	count
Agent G2 - Microsoft Windows Lsa counters	microsoft_windows_Lsa_SecurityPerProcessStatistics_ContextHandles	Microsoft Windows Lsa SecurityPerProcessStatistics ContextHandles	count	This counter tracks the number of context handles in use by a given process. Context handles are associated with security contexts established between a client application and a remote peer.

Agent G2 - Microsoft Windows Message Queuing service Counters

Description

Microsoft Windows Message Queuing service Counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Windows Message Queuing service Counters	microsoft_windows_MSMQService_IncomingMessagesPersec	Microsoft Windows MSMQService IncomingMessagesPersec	NULL	The rate at which incoming Message Queuing messages are placed in queues on the selected computer by the Message Queuing service.

Agent G2 - Microsoft Windows MSOLAP Performance Counters

Description

Microsoft Windows MSOLAP Performance Counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Windows MSOLAP Performance Counters	microsoft_windows_MSOLAPDUMMYINSTConnection_CurrentConnections	Microsoft Windows MSOLAPDUMMYINSTConnection CurrentConnections	count	Current number of client connections established.
	microsoft_windows_MSOLAPDUMMYINSTProcIndexes_Currentpartitions	Microsoft Windows MSOLAPDUMMYINSTProcIndexes Currentpartitions	count	Current number of partitions being processed.
	microsoft_windows_MSOLAPDUMMYINSTThreads_LongParsingBusyThreads	Microsoft Windows MSOLAPDUMMYINSTThreads LongParsingBusyThreads	count	Number of busy threads in the long parsing thread pool.
	microsoft_windows_MSOLAPDUMMYINSTMemory_AggCacheKB	Current memory allocated to aggregation cache, in KB.	KB
	microsoft_windows_MSOLAPDUMMYINSTProcessing_RowsConvertedPersec	Microsoft Windows MSOLAPDUMMYINSTProcessing RowsConvertedPersec	NULL	Rate of rows converted during processing.
	microsoft_windows_MSOLAPDUMMYINSTDataMiningPrediction_ConcurrentDMqueries	Microsoft Windows MSOLAPDUMMYINSTDataMiningPrediction ConcurrentDMqueries	count	Current number of Data Mining queries being actively worked on.
	microsoft_windows_MSOLAPDUMMYINSTCache_CurrentEntries	Microsoft Windows MSOLAPDUMMYINSTCache CurrentEntries	count	Current number of cache entries.
	microsoft_windows_MSOLAPDUMMYINSTProactiveCaching_NotificationsPersec	Microsoft Windows MSOLAPDUMMYINSTProactiveCaching NotificationsPersec	NULL	Rate of notifications from relational database.
	microsoft_windows_MSOLAPDUMMYINSTLocks_CurrentLatchWaits	Microsoft Windows MSOLAPDUMMYINSTLocks CurrentLatchWaits	count	Current number of threads waiting for a latch. These are latch requests that could not be given immediate grants and are in a wait state.
	microsoft_windows_MSOLAPDUMMYINSTStorageEngineQuery_AggregationHitsPersec	Microsoft Windows MSOLAPDUMMYINSTStorageEngineQuery AggregationHitsPersec	NULL	Rate of aggregation hits.
	microsoft_windows_MSOLAPDUMMYINSTProcAggregations_CurrentPartitions	Microsoft Windows MSOLAPDUMMYINSTProcAggregations CurrentPartitions	count	Current number of partitions being processed.
	microsoft_windows_MSOLAPDUMMYINSTMDX_CurrentNumberofCachedEvaluationNodes	Microsoft Windows MSOLAPDUMMYINSTMDX CurrentNumberofCachedEvaluationNodes	count	Current (approximate) number of cached evaluation nodes built by MDX execution plans
	microsoft_windows_MSOLAPDUMMYINST_DataMiningModelProcessing_CasesPersec	Microsoft Windows MSOLAPDUMMYINST DataMiningModelProcessing CasesPersec	NULL	Rate of processing cases.

Agent G2 - Microsoft Windows OS Counters - RSE

Description

Microsoft Windows OS Counters - RSE

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Windows OS Counters - RSE	microsoft_windows_Memory_PageFaultsPersec	Microsoft Windows Memory PageFaultsPersec	NULL	Page Faults/sec is the average number of pages faulted per second. It is measured in number of pages faulted per second because only one page is faulted in each fault operation, hence this is also equal to the number of page fault operations. This counter includes both hard faults (those that require disk access) and soft faults (where the faulted page is found elsewhere in physical memory.) Most processors can handle large numbers of soft faults without significant consequence. However, hard faults, which require disk access, can cause significant delays.
	microsoft_windows_System_ProcessorQueueLength	Microsoft Windows System ProcessorQueueLength	NULL	Processor Queue Length is the number of threads in the processor queue. Unlike the disk counters, this counter counters, this counter shows ready threads only, not threads that are running. There is a single queue for processor time even on computers with multiple processors. Therefore, if a computer has multiple processors, you need to divide this value by the number of processors servicing the workload. A sustained processor queue of less than 10 threads per processor is normally acceptable, dependent of the workload.
	microsoft_windows_Processor_PercentPrivilegedTime	Microsoft Windows Processor PercentPrivilegedTime	%	% Privileged Time is the percentage of elapsed time that the process threads spent executing code in privileged mode. When a Windows system service in called, the service will often run in privileged mode to gain access to systemprivate data. Such data is protected from access by threads executing in user mode. Calls to the system can be explicit or implicit, such as page faults or interrupts. Unlike some early operating systems, Windows uses process boundaries for subsystem protection in addition to the traditional protection of user and privileged modes. Some work done by Windows on behalf of the application might appear in other subsystem processes in addition to the privileged time in the process.
	microsoft_windows_ProcessorInformation_PercentC1Time	Microsoft Windows ProcessorInformation PercentC1Time	%	% C1 Time is the percentage of time the processor spends in the C1 low-power idle state. % C1 Time is a subset of the total processor idle time. C1 low-power idle state enables the processor to maintain its entire context and quickly return to the running state. Not all systems support the % C1 state.
	microsoft_windows_PagingFile_PercentUsage	Microsoft Windows PagingFile PercentUsage	%	The amount of the Page File instance in use in percent. See also Process\\\\Page File Bytes.
	microsoft_windows_PhysicalDisk_AvgDiskBytesPerRead	Microsoft Windows PhysicalDisk AvgDiskBytesPerRead	count	Avg. Disk Bytes/Read is the average number of bytes transferred from the disk during read operations.
	microsoft_windows_ASP_InMemoryTemplatesCached	Microsoft Windows ASP InMemoryTemplatesCached	count	The number of compiled templates cached in memory.
	microsoft_windows_LogicalDisk_PercentIdleTime	Microsoft Windows LogicalDisk PercentIdleTime	%	% Idle Time reports the percentage of time during the sample interval that the disk was idle.

Agent G2 - Microsoft Windows IIS App Pool State

Description

Monitors IIS App Pool States for the given app pool names by fetching the App Pool Names from Internet Information Services (IIS) Manager > Application Pools > Column ‘Name’. By default, it will monitor all the available App Pools because the default value is ‘all’ Otherwise, it will monitor the given exact app pool names separated by commas (avoid spaces for each app pool name). Status of the application pool (1 - Uninitialized, 2 - Initialized, 3 - Running, 4 - Disabling, 5 - Disabled, 6 - Shutdown Pending, 7 - Delete Pending).

Prerequisites

No prerequisite

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Windows IIS App Pool State	microsoft_windows_iis_appPool_state	Microsoft Windows IIS App Pool State	State	Monitors IIS App Pool States for the given app pool names by fetching the App Pool Names from Internet Information Services (IIS) Manager > Application Pools > Column 'Name'. By default, it will monitor all the available App Pools because the default value is 'all.' Otherwise, it will monitor the given exact app pool names separated by commas (avoid spaces for each app pool name). Status of the application pool (1 - Uninitialized, 2 - Initialized, 3 - Running, 4 - Disabling, 5 - Disabled, 6 - Shutdown Pending, 7 - Delete Pending).

Agent G2 - Microsoft Active Directory Domain Controller Performance and Availability

Description

Monitors Active Directory metrics like Global Catalog Bind Time, Global Catalog Search Time, DNS Servers Bind Time, Lost Object Count, SYSVol Share availability.

Prerequisites

No prerequisite

Supported Metric

Monitor Name	Monitor Description	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft AD DNS Server Bind Time	Monitors network connectivity test to the specified DNS server IP's. Example: 127.0.0.1 127.0.0.3	microsoft_AD_DNS_server_bindTime	Microsoft AD DNS Server BindTime	ms	Monitors Microsoft Active Directory network connectivity tests to the specified DNS server IPs.
Agent G2 - Microsoft AD Global Catalog Bind Time	Monitors Active Directory Global Catalog Bind Time in Milliseconds. User need to provide AD Domain Controller IP along with its port with : separated. Example: 127.0.0.1:3268	microsoft_AD_global_catalog_bindTime	Microsoft AD Global Catalog BindTime	ms	Monitors Microsoft Active Directory Global Catalog Bind Time in milliseconds.
Agent G2 - Microsoft AD Global Catalog Search Time	Monitors Active Directory Global catalog search time in milliseconds using given Domain Controller IPS's and its associated filter. It measures the time it takes to perform the search operation. User need to provide Domain Controller IP:port and LDAP Filter Name. Example: DomainControllerIP_and_Port: 127.0.0.1:3268 AD_LDAP_Filter: organization	microsoft_AD_global_catalog_searchTime	Microsoft AD Global Catalog SearchTime	ms	Monitors Microsoft Active Directory Global Catalog Search Time in milliseconds
Agent G2 - Microsoft AD LostObjectCount_SYSVOLShareAvailability	Monitor the count of deleted Active Directory objects and availability of the Active Directory SYSVOL share.	microsoft_AD_lost_object_count	Microsoft AD Lost Object Count	count	Monitors the count of deleted Active Directory objects.
Agent G2 - Microsoft AD LostObjectCount_SYSVOLShareAvailability	Monitor the count of deleted Active Directory objects and availability of the Active Directory SYSVOL share.	microsoft_AD_SYSVOL_share_availability	Microsoft AD SYSVOL Share Availability	null	Monitors Microsoft Active Directory SYSVOL share is available or not.

Agent G2 - Microsoft Active Directory Domain Controller Performance and Availability - v2

Description

Monitors Active Directory metrics like Global Catalog Bind Time, Global Catalog Search Time, DNS Servers Bind Time, Lost Object Count, SYSVol Share availability.

Prerequisites

No Prerequisites

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft AD DNS Server Bind Time	microsoft_AD_DNS_server_bindTime	Microsoft AD DNS Server BindTime	ms	Monitors Microsoft Active Directory network connectivity tests to the specified DNS server IPs.
Agent G2 - Microsoft AD Global Catalog Bind Time	microsoft_AD_global_catalog_bindTime	Microsoft AD Global Catalog BindTime	ms	Monitors Microsoft Active Directory Global Catalog Bind Time in milliseconds
Agent G2 - Microsoft AD Global Catalog Search Time	microsoft_AD_global_catalog_searchTime	Microsoft AD Global Catalog SearchTime	ms	Monitors Microsoft Active Directory Global Catalog Search Time in milliseconds
Agent G2 - Microsoft AD LostObjectCount_SYSVOLShareAvailability	microsoft_AD_lost_object_count	Microsoft AD Lost Object Count	count	Monitors the count of deleted Active Directory objects.
Agent G2 - Microsoft AD LostObjectCount_SYSVOLShareAvailability	microsoft_AD_SYSVOL_share_availability	Microsoft AD SYSVOL Share Availability	null	Monitors Microsoft Active Directory SYSVOL share is available or not.
Agent G2 - Microsoft AD BindTime	microsoft_AD_bindTime	Microsoft AD BindTime	ms	Monitors Active Directory BindTime for Domain Controller, Infrastructure Master, Domain Naming Master, Primary Domain Controller Emulator (PDC), Relative ID master (RID), Schema Master (SCH) in milliseconds.
Agent G2 - Microsoft AD LastSuccessful Synchronization Time	microsoft_AD_lastSuccessfulSyncTime	Microsoft AD LastSuccessfulSync Time	m	Monitors Microsoft Active Directory last successful synchronization time in minutes.

Agent G2 - Microsoft Windows OS Counters - RSE - v2

Description

To Monitor OS related counters like disk,memory

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows Memory Custom Monitor - v2	system.windows.memory.available	System Windows Memory Available	MB	Available MBytes is the amount of physical memory, in Megabytes, immediately available for allocation to a process or for system use. It is equal to the sum of memory assigned to the standby (cached), free and zero page lists.
	system_windows_Memory_committedBytesInuse	System Windows Memory Committed Bytes Inuse	%	% Committed Bytes In Use is the ratio of Memory\\\\Committed Bytes to the Memory\\\\Commit Limit. Committed memory is the physical memory in use for which space has been reserved in the paging file should it need to be written to disk. The commit limit is determined by the size of the paging file. If the paging file is enlarged, the commit limit increases, and the ratio is reduced). This counter displays the current percentage value only; it is not an average.
	system_windows_pagesInputPerSec	System Windows Pages Input PerSec	psec	Pages Input/sec is the rate at which pages are read from disk to resolve hard page faults. Hard page faults occur when a process refers to a page in virtual memory that is not in its working set or elsewhere in physical memory, and must be retrieved from disk. When a page is faulted, the system tries to read multiple contiguous pages into memory to maximize the benefit of the read operation. Compare the value of Memory\\\\Pages Input/sec to the value of Memory\\\\Page Reads/sec to determine the average number of pages read into memory during each read operation.
	microsoft_windows_Memory_PageFaultsPersec	Microsoft Windows Memory PageFaultsPersec	psec	Page Faults/sec is the average number of pages faulted per second. It is measured in number of pages faulted per second because only one page is faulted in each fault operation, hence this is also equal to the number of page fault operations. This counter includes both hard faults (those that require disk access) and soft faults (where the faulted page is found elsewhere in physical memory.) Most processors can handle large numbers of soft faults without significant consequence. However, hard faults, which require disk access, can cause significant delays.
	system_windows_pagesOutputPerSec	System Windows Pages Output PerSec	psec	Pages Output/sec is the rate at which pages are written to disk to free up space in physical memory. Pages are written back to disk only if they are changed in physical memory, so they are likely to hold data, not code. A high rate of pages output might indicate a memory shortage. Windows writes more pages back to disk to free up space when physical memory is in short supply. This counter shows the number of pages, and can be compared to other counts of pages, without conversion.
	system_windows_Memory_pagesPerSec	System Windows Memory Pages PerSec	psec	Pages/sec is the rate at which pages are read from or written to disk to resolve hard page faults. This counter is a primary indicator of the kinds of faults that cause system-wide delays. It is the sum of Memory\\\\Pages Input/sec and Memory\\\\Pages Output/sec. It is counted in numbers of pages, so it can be compared to other counts of pages, such as Memory\\\\Page Faults/sec, without conversion. It includes pages retrieved to satisfy faults in the file system cache (usually requested by applications) non-cached mapped memory files.
	system_windows_Memory_CommittedBytes	System Windows Memory CommittedBytes	Bytes	Committed Bytes is the amount of committed virtual memory, in bytes. Committed memory is the physical memory which has space reserved on the disk paging file(s). There can be one or more paging files on each physical drive. This counter displays the last observed value only; it is not an average.
	System_Windows_Memory_CommitLimit	System Windows Memory CommitLimit	Bytes	Commit Limit is the amount of virtual memory that can be committed without having to extend the paging file(s). It is measured in bytes. Committed memory is the physical memory which has space reserved on the disk paging files. There can be one paging file on each logical drive). If the paging file(s) are be expanded, this limit increases accordingly. This counter displays the last observed value only; it is not an average.
System Windows LogicalDisk Monitor	system_windows_logicaldisk_UsedSpaceInMegaBytes	System Windows LogicalDisk UsedSpace In MegaBytes	MB	Total usable space on the selected logical disk drive that was free in MB
	system_windows_logicaldisk_DiskReadPerSecond	System Windows LogicalDisk DiskRead PerSecond	rops	Disk Reads/sec is the rate of read operations on the disk.
	system_windows_logicaldisk_AvgDiskSecPerRead	System Windows LogicalDisk AvgDiskSec PerRead	null	Avg. Disk sec/Read is the average time, in seconds, of a read of data from the disk.
	system_windows_logicaldisk_AvgDiskQueueLength	System Windows LogicalDisk AvgDiskQueueLength	null	Avg. Disk Queue Length is the average number of both read and write requests that were queued for the selected disk during the sample interval.
	system_windows_logicaldisk_FreeSpaceInPercent	System Windows LogicalDisk FreeSpace In Percent	%	% Free Space is the percentage of total usable space on the selected logical disk drive that was free.
	system_windows_logicaldisk_FreeSpaceInMB	System Windows LogicalDisk FreeSpace InMB	MB	Free Megabytes displays the unallocated space, in megabytes, on the disk drive in megabytes. One megabyte is equal to 1,048,576 bytes.
	system_windows_logicaldisk_DiskWriteBytesPerSecond	System Windows Logicaldisk DiskWriteBytes PerSecond	Bps	Disk Write Bytes/sec is rate at which bytes are transferred to the disk during write operations.
	system_windows_logicaldisk_DiskWritePerSecond	System windows LogicalDisk DiskWrite PerSecond	wops	Disk Writes/sec is the rate of write operations on the disk.
	system_windows_logicaldisk_DiskReadBytesPerSecond	System Windows LogicalDisk DiskReadBytes PerSecond	Bps	Disk Read Bytes/sec is the rate at which bytes are transferred from the disk during read operations.
	system_windows_logicaldisk_AvgDiskSecPerWrite	System Windows LogicalDisk AvgDiskSec PerWrite	null	Avg. Disk sec/Write is the average time, in seconds, of a write of data to the disk.
System Windows Processor Monitor	microsoft_windows_Processor_PercentPrivilegedTime	Microsoft Windows Processor PercentPrivilegedTime	%	% Privileged Time is the percentage of elapsed time that the process threads spent executing code in privileged mode. When a Windows system service in called, the service will often run in privileged mode to gain access to system-private data. Such data is protected from access by threads executing in user mode. Calls to the system can be explicit or implicit, such as page faults or interrupts. Unlike some early operating systems, Windows uses process boundaries for subsystem protection in addition to the traditional protection of user and privileged modes. Some work done by Windows on behalf of the application might appear in other subsystem processes in addition to the privileged time in the process.
	system_windows_processorDPCrate	System Windows Processor DPCrate	null	DPC Rate is the rate at which deferred procedure calls (DPCs) were added to the processors DPC queues between the timer ticks of the processor clock. DPCs are interrupts that run at alower priority than standard interrupts. Each processor has its own DPC queue. This counter measures the rate that DPCs were added to the queue, not the number of DPCs in the queue. This counter displays the last observed value only; it is not an average.
	system_windows_processor_percentprocessortime	System Windows Processor PercentProcessorTime	%	% Processor Time is the percentage of elapsed time that the processor spends to execute a non-Idle thread. It is calculated by measuring the percentage of time that the processor spends executing the idle thread and then subtracting that value from 100%. (Each processor has an idle thread that consumes cycles when no other threads are ready to run). This counter is the primary indicator of processor activity, and displays the average percentage of busy time observed during the sample interval. It should be noted that the accounting calculation of whether the processor is idle is performed at an internal sampling interval of the system clock (10ms). On todays fast processors, % Processor Time can therefore underestimate the processor utilization as the processor may be spending a lot of time servicing threads between the system clock sampling interval. Workload based timer applications are one example of applications which are more likely to be measured inaccurately as timers are signaled just after the sample is taken.
	system_windows_processorInterruptsPerSec	System Windows ProcessorInterrupts PerSec	psec	Interrupts/sec is the average rate, in incidents per second, at which the processor received and serviced hardware interrupts. It does not include deferred procedure calls (DPCs), which are counted separately. This value is an indirect indicator of the activity of devices that generate interrupts, such as the system clock, the mouse, disk drivers, data communication lines, network interface cards, and other peripheral devices. These devices normally interrupt the processor when they have completed a task or require attention. Normal thread execution is suspended. The system clock typically interrupts the processor every 10 milliseconds, creating a background of interrupt activity. This counter displays the difference between the values observed in the last two samples, divided by the duration of the sample interval.
	microsoft_windows_ProcessorInformation_PercentC1Time	Microsoft Windows ProcessorInformation PercentC1Time	%	% C1 Time is the percentage of time the processor spends in the C1 low-power idle state. % C1 Time is a subset of the total processor idle time. C1 low-power idle state enables the processor to maintain its entire context and quickly return to the running state. Not all systems support the % C1 state
	microsoft_windows_ASP_InMemoryTemplatesCached	Microsoft Windows ASP InMemoryTemplatesCached	count	The number of compiled templates cached in memory.
System Windows Server Monitor	system_windows_server_logonsPerSec	System Windows Server LogonsPerSec	psec	Logon/sec is the rate of all server logons.
	system_windows_contextSwitchesPerSec	System Windows ContextSwitchesPerSec	psec	"Context Switches/sec is the combined rate at which all processors on the computer are switched from one thread to another. Context switches occur when a running thread voluntarily relinquishes the processor, is preempted by a higher priority ready thread, or switches between user-mode and privileged (kernel) mode to use an Executive or subsystem service. It is the sum of Thread Context Switches/sec for all threads running on all processors in the computer and is measured in numbers of switches. There are context switch counters on the System and Thread objects. This counter displays the difference between the values observed in the last two samples, divided by the duration of the sample interval."
	system_windows_bytesTransmittedPerSec	System Windows BytesTransmitted PerSec	psec	The number of bytes the server has sent on the network. Indicates how busy the server is.
	microsoft_windows_System_ProcessorQueueLength	Microsoft Windows System ProcessorQueueLength	null	Processor Queue Length is the number of threads in the processor queue. Unlike the disk counters, this counter counters, this counter shows ready threads only, not threads that are running. There is a single queue for processor time even on computers with multiple processors. Therefore, if a computer has multiple processors, you need to divide this value by the number of processors servicing the workload. A sustained processor queue of less than 10 threads per processor is normally acceptable, dependent of the workload.
	system_windows_bytesReceivedPerSec	System Windows BytesReceived PerSec	psec	The number of bytes the server has received from the network. Indicates how busy the server is.
System Windows PhysicalDisk Monitor	system_windows_PhysicalDisk_writesPerSec	System Windows PhysicalDisk Writes PerSec	psec	Disk Writes/sec is the rate of write operations on the disk.
	system_windows_PhysicalDisk_avgDiskSecPerRead	System Windows PhysicalDisk AvgDiskSec PerRead	null	Avg. Disk sec/Read is the average time, in seconds, of a read of data from the disk.
	system_windows_PhysicalDisk_writeBytesPerSec	System Windows PhysicalDisk WriteBytes PerSec	Bps	Disk Write Bytes/sec is rate at which bytes are transferred to the disk during write operations.
	System_Windows_PhysicalDisk_readBytesPerSec	System Windows PhysicalDisk ReadBytes PerSec	Bps	Disk Read Bytes/sec is the rate at which bytes are transferred from the disk during read operations.
	System_Windows_PhysicalDisk_avgDiskSecPerWrite	System Windows PhysicalDisk AvgDiskSec PerWrite	null	Avg. Disk sec/Write is the average time, in seconds, of a write of data to the disk.
	system_windows_PhysicalDisk_readsPerSec	System Windows PhysicalDisk ReadsPerSec	psec	Disk Reads/sec is the rate of read operations on the disk.
	System_Windows_PhysicalDisk_avgDiskQueueLength	System Windows PhysicalDisk avgDiskQueueLength	null	Avg. Disk Queue Length is the average number of both read and write requests that were queued for the selected disk during the sample interval.
	microsoft_windows_PhysicalDisk_AvgDiskBytesPerRead	Microsoft Windows PhysicalDisk AvgDiskBytesPerRead	null	Avg. Disk Bytes/Read is the average number of bytes transferred from the disk during read operations.
	microsoft_windows_PagingFile_PercentUsage	Microsoft Windows PagingFile PercentUsage	%	The amount of the Page File instance in use in percent

Agent G2 - Microsoft Windows OS Counters - RSE - v3

Description

To Monitor OS related counters like disk, memory. In this version, added these additonal metrics support: system_windows_Memory_TotalInstalledRAM,system_windows_Memory_UsedRAM,system_windows_Memory_CommitCharge,system_windows_Memory_PageFileInstalled

Prerequisites

No Prerequisites

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
System Windows LogicalDisk Monitor	system_windows_logicaldisk_UsedSpaceInMegaBytes	System Windows LogicalDisk UsedSpace In MegaBytes	MB	Total usable space on the selected logical disk drive that was free in MB
	system_windows_logicaldisk_DiskReadPerSecond	System Windows LogicalDisk DiskRead PerSecond	rops	Disk Reads/sec is the rate of read operations on the disk.
	system_windows_logicaldisk_AvgDiskSecPerRead	System Windows LogicalDisk AvgDiskSec PerRead	null	Avg. Disk sec/Read is the average time, in seconds, of a read of data from the disk.
	system_windows_logicaldisk_AvgDiskQueueLength	System Windows LogicalDisk AvgDiskQueueLength	null	Avg. Disk Queue Length is the average number of both read and write requests that were queued for the selected disk during the sample interval.
	system_windows_logicaldisk_FreeSpaceInPercent	System Windows LogicalDisk FreeSpace In Percent	%	% Free Space is the percentage of total usable space on the selected logical disk drive that was free.
	system_windows_logicaldisk_FreeSpaceInMB	System Windows LogicalDisk FreeSpace InMB	MB	Free Megabytes displays the unallocated space, in megabytes, on the disk drive in megabytes. One megabyte is equal to 1,048,576 bytes.
	system_windows_logicaldisk_DiskWriteBytesPerSecond	System Windows Logicaldisk DiskWriteBytes PerSecond	Bps	Disk Write Bytes/sec is rate at which bytes are transferred to the disk during write operations.
	system_windows_logicaldisk_DiskWritePerSecond	System windows LogicalDisk DiskWrite PerSecond	wops	Disk Writes/sec is the rate of write operations on the disk.
	system_windows_logicaldisk_DiskReadBytesPerSecond	System Windows LogicalDisk DiskReadBytes PerSecond	Bps	Disk Read Bytes/sec is the rate at which bytes are transferred from the disk during read operations.
	system_windows_logicaldisk_AvgDiskSecPerWrite	System Windows LogicalDisk AvgDiskSec PerWrite	null	Avg. Disk sec/Write is the average time, in seconds, of a write of data to the disk.
System Windows Processor Monitor	microsoft_windows_Processor_PercentPrivilegedTime	Microsoft Windows Processor PercentPrivilegedTime	%	% Privileged Time is the percentage of elapsed time that the process threads spent executing code in privileged mode. When a Windows system service in called, the service will often run in privileged mode to gain access to system-private data. Such data is protected from access by threads executing in user mode. Calls to the system can be explicit or implicit, such as page faults or interrupts. Unlike some early operating systems, Windows uses process boundaries for subsystem protection in addition to the traditional protection of user and privileged modes. Some work done by Windows on behalf of the application might appear in other subsystem processes in addition to the privileged time in the process.
	system_windows_processorDPCrate	System Windows Processor DPCrate	null	DPC Rate is the rate at which deferred procedure calls (DPCs) were added to the processors DPC queues between the timer ticks of the processor clock. DPCs are interrupts that run at alower priority than standard interrupts. Each processor has its own DPC queue. This counter measures the rate that DPCs were added to the queue, not the number of DPCs in the queue. This counter displays the last observed value only; it is not an average.
	system_windows_processor_percentprocessortime	System Windows Processor PercentProcessorTime	%	% Processor Time is the percentage of elapsed time that the processor spends to execute a non-Idle thread. It is calculated by measuring the percentage of time that the processor spends executing the idle thread and then subtracting that value from 100%. (Each processor has an idle thread that consumes cycles when no other threads are ready to run). This counter is the primary indicator of processor activity, and displays the average percentage of busy time observed during the sample interval. It should be noted that the accounting calculation of whether the processor is idle is performed at an internal sampling interval of the system clock (10ms). On todays fast processors, % Processor Time can therefore underestimate the processor utilization as the processor may be spending a lot of time servicing threads between the system clock sampling interval. Workload based timer applications are one example of applications which are more likely to be measured inaccurately as timers are signaled just after the sample is taken.
	system_windows_processorInterruptsPerSec	System Windows ProcessorInterrupts PerSec	psec	Interrupts/sec is the average rate, in incidents per second, at which the processor received and serviced hardware interrupts. It does not include deferred procedure calls (DPCs), which are counted separately. This value is an indirect indicator of the activity of devices that generate interrupts, such as the system clock, the mouse, disk drivers, data communication lines, network interface cards, and other peripheral devices. These devices normally interrupt the processor when they have completed a task or require attention. Normal thread execution is suspended. The system clock typically interrupts the processor every 10 milliseconds, creating a background of interrupt activity. This counter displays the difference between the values observed in the last two samples, divided by the duration of the sample interval.
	microsoft_windows_ProcessorInformation_PercentC1Time	Microsoft Windows ProcessorInformation PercentC1Time	%	% C1 Time is the percentage of time the processor spends in the C1 low-power idle state. % C1 Time is a subset of the total processor idle time. C1 low-power idle state enables the processor to maintain its entire context and quickly return to the running state. Not all systems support the % C1 state
	microsoft_windows_ASP_InMemoryTemplatesCached	Microsoft Windows ASP InMemoryTemplatesCached	count	The number of compiled templates cached in memory.
System Windows PhysicalDisk Monitor	system_windows_PhysicalDisk_writesPerSec	System Windows PhysicalDisk Writes PerSec	psec	Disk Writes/sec is the rate of write operations on the disk.
	system_windows_PhysicalDisk_avgDiskSecPerRead	System Windows PhysicalDisk AvgDiskSec PerRead	null	Avg. Disk sec/Read is the average time, in seconds, of a read of data from the disk.
	system_windows_PhysicalDisk_writeBytesPerSec	System Windows PhysicalDisk WriteBytes PerSec	Bps	Disk Write Bytes/sec is rate at which bytes are transferred to the disk during write operations.
	System_Windows_PhysicalDisk_readBytesPerSec	System Windows PhysicalDisk ReadBytes PerSec	Bps	Disk Read Bytes/sec is the rate at which bytes are transferred from the disk during read operations.
	System_Windows_PhysicalDisk_avgDiskSecPerWrite	System Windows PhysicalDisk AvgDiskSec PerWrite	null	Avg. Disk sec/Write is the average time, in seconds, of a write of data to the disk.
	system_windows_PhysicalDisk_readsPerSec	System Windows PhysicalDisk ReadsPerSec	psec	Disk Reads/sec is the rate of read operations on the disk.
	System_Windows_PhysicalDisk_avgDiskQueueLength	System Windows PhysicalDisk avgDiskQueueLength	null	Avg. Disk Queue Length is the average number of both read and write requests that were queued for the selected disk during the sample interval.
	microsoft_windows_PhysicalDisk_AvgDiskBytesPerRead	Microsoft Windows PhysicalDisk AvgDiskBytesPerRead	null	Avg. Disk Bytes/Read is the average number of bytes transferred from the disk during read operations.
	microsoft_windows_PagingFile_PercentUsage	Microsoft Windows PagingFile PercentUsage	%	The amount of the Page File instance in use in percent
System Windows Server Monitor	system_windows_server_logonsPerSec	System Windows Server LogonsPerSec	psec	Logon/sec is the rate of all server logons.
	system_windows_contextSwitchesPerSec	System Windows ContextSwitchesPerSec	psec	"Context Switches/sec is the combined rate at which all processors on the computer are switched from one thread to another. Context switches occur when a running thread voluntarily relinquishes the processor, is preempted by a higher priority ready thread, or switches between user-mode and privileged (kernel) mode to use an Executive or subsystem service. It is the sum of Thread Context Switches/sec for all threads running on all processors in the computer and is measured in numbers of switches. There are context switch counters on the System and Thread objects. This counter displays the difference between the values observed in the last two samples, divided by the duration of the sample interval."
	system_windows_bytesTransmittedPerSec	System Windows BytesTransmitted PerSec	psec	The number of bytes the server has sent on the network. Indicates how busy the server is.
	microsoft_windows_System_ProcessorQueueLength	Microsoft Windows System ProcessorQueueLength	null	Processor Queue Length is the number of threads in the processor queue. Unlike the disk counters, this counter counters, this counter shows ready threads only, not threads that are running. There is a single queue for processor time even on computers with multiple processors. Therefore, if a computer has multiple processors, you need to divide this value by the number of processors servicing the workload. A sustained processor queue of less than 10 threads per processor is normally acceptable, dependent of the workload.
	system_windows_bytesReceivedPerSec	System Windows BytesReceived PerSec	psec	The number of bytes the server has received from the network. Indicates how busy the server is.
Agent G2 - Windows Memory Custom Monitor - v3	System_Windows_Pages_Output_PerSec	System_Windows_Pages_Output_PerSec	psec
	System_Windows_Memory_AvailableMbytes	System_Windows_Memory_AvailableMbytes	MB	Calculates the Memory Available in Mega Bytes of the System
	System_Windows_Memory_CommitLimit	System_Windows_Memory_CommitLimit	Bytes	Calculates the physical memory space reserved on the disk paging files
	System_Windows_Memory_CommittedBytes	System_Windows_Memory_CommittedBytes	Bytes	Calculates the Total Number of Committed Bytes of the System
	System_Windows_Memory_CommittedBytes_Inuse	System_Windows_Memory_CommittedBytes_Inuse	Bytes	Calculates the Percentage of the Committed Bytes In use of the System
	System_Windows_Memory_PageFaults_PerSec	System_Windows_Memory_PageFaults_PerSec	psec	Calculates the Total Number of Memory Page Faults Per Second of the System
	System_Windows_Memory_Pages_PerSec	System_Windows_Memory_Pages_PerSec	psec	Calculates the Total Number of Memory pages per second of the System
	system_windows_rawdata_pagesIn_PerSecond	system_windows_rawdata_pagesIn_PerSecond	null
	system_windows_Memory_TotalInstalledRAM	System Windows Memory TotalInstalledRAM	GB	Total PhysicalMemory(RAM) in GB
	system_windows_Memory_UsedRAM	System Windows Memory UsedRAM	GB	Used PhysicalMemory(RAM) in GB
	system_windows_Memory_CommitCharge	System Windows Memory CommitCharge	GB	Commit Charge is the amount of committed virtual memory. Committed memory is the physical memory which has space reserved on the disk paging file(s). There can be one or more paging files on each physical drive. This counter displays the last observed value only; it is not an average.
	system_windows_Memory_PageFileInstalled	System Windows Memory PageFileInstalled	GB	Page File Installed(Commit Limit) is the amount of virtual memory that can be committed without having to extend the paging file(s). Committed memory is the physical memory which has space reserved on the disk paging files. There can be one paging file on each logical drive). If the paging file(s) are be expanded, this limit increases accordingly. This counter displays the last observed value only; it is not an average.

Agent G2 - MSSQL Database Availability Status - v2

Description

Monitors MSSQL Instance Connection Time in milliseconds and Database Instance status along with Database Status. If the Instance is in a running state and the Databases associated with the instance is offline, it considers the Instance as Down. Conversely, if the Instance is in a running state and the associated Database is up, it considers the Instance as Up. Default value is ‘all’ i.e., it will monitor all databases. If user need to monitor any particular databases, then provide the database names with comma separated. Example: master,msdb,temp.

Prerequisites

Database credentials must be added to the resource with the type set to “Database.”

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - MSSQL Database Availability Status - v2	mssql_database_availability_status	MSSQL Database Availability Status	Status	MSSQL Database Availability Status
Agent G2 - MSSQL Database Availability Status - v2	mssql_database_connection_time	MSSQL Database Connection Time	ms	Monitors MSSQL Database Instance Connection Time in milliseconds

Agent G2 - MSSQL Database Data and Log Files Freespace and Utilization

Description

Monitors MSSQL Database Log & Data file Freespace and utilization.

Prerequisites

Requires Agent version 14.0.0 or later. MSSQL database credentials must be added to the device. When assigning the template, user need to provide the MSSQL Server name (if they have multiple instances, provide it in this format: ServerName InstanceName) and MSSQL instance name (instance names will be available in services.msc) and mention that the authentication type is Windows or SQL.

Template Usage Guidelines:

Requires Agent version 14.0.0 or later.
MSSQL database credentials must be added to the device.
When assigning the template, user need to provide the MSSQL Server name (if they have multiple instances, provide it in this format: ServerName InstanceName) and MSSQL instance name (instance names will be available in services.msc) and mention that the authentication type is Windows or SQL.

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - MSSQL Database Data and Log Files Freespace and Utilization	mssql_database_logFilesFreeSpace	MSSQL Database LogFileFreeSpace	%	Monitors MSSQL database LogFiles free space
	mssql_database_dataFilesFreeSpace	MSSQL Database DataFilesFreeSpace	%	Monitors MSSQL datafiles free space regardless of auto-growth
	mssql_database_ldf_file_utilization_percentage	MSSQL Database ldf File Utilization in Percentage	%	Monitors MSSQL .ldf files utilization in percentage
	mssql_database_ndf_file_utilization_percentage	MSSQL Database ndf File Utilization Percentage	%	Monitors MSSQL .ndf files utilization in percentage
	mssql_database_mdf_file_utilization_percentage	MSSQL Database mdf File Utilization Percentage	%	Monitors MSSQL .mdf files utilization in percentage

Agent G2 - MSSQL Database Agent Job Status

Description

Monitors MSSQL Agent Job Status latest information (in last 15mins only): Below are the possible status values - 0 : Failed 1 : Successful 2 : Retry 3 : Cancelled 4 : InProgress.

Prerequisites

Template Usage Guidelines:

Requires Agent version 14.0.0 or later.
MSSQL database credentials must be added to the device.
When assigning the template, user need to provide the MSSQL Server name (if they have multiple instances, provide it in this format: ServerName InstanceName) and MSSQL instance name (instance names will be available in services.msc) and mention that the authentication type is Windows or SQL.

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - MSSQL Database Agent Job Status	mssql_database_agentJobStatus	MSSQL Database AgentJobStatus		MSSQL DB Agent Jobs Status : This metric collects mssql agent job status latest information (in last 15mins only): Below are the possible status values - 0 : Failed 1 : Successful 2 : Retry 3 : Cancelled 4 : InProgress

Agent G2 - Microsoft Windows MSSQL Performance and Statistics

Description:

Monitors the various performance statistics of MSSQL from versions 2000 to 2022. Ensure that required WMI classes be available in system.

Template Usage Guidelines:

While applying this template on the device, users need to provide specific input parameters specifying version of MSSQL. The default value is set to “MSSQL2022.”

Example 1: MSSQL2022

This monitors the MSSQL 2022 statistics for given metrics.

Example 2: MSSQL2019

This monitors the MSSQL 2019 statistics for given metrics.

Below are the Namespaces associated to MSSQL version.

“MSSQL2000” namespace = “root\Microsoft\SqlServer\ComputerManagement” “MSSQL2005” namespace = “root\Microsoft\SqlServer\ComputerManagement” “MSSQL2008” namespace = “root\Microsoft\SqlServer\ComputerManagement10” “MSSQL2012” namespace = “root\Microsoft\SqlServer\ComputerManagement11” “MSSQL2014” namespace = “root\Microsoft\SqlServer\ComputerManagement12” “MSSQL2016” namespace = “root\Microsoft\SqlServer\ComputerManagement13” “MSSQL2017” namespace = “root\Microsoft\SqlServer\ComputerManagement14” “MSSQL2019” namespace = “root\Microsoft\SqlServer\ComputerManagement15” “MSSQL2022” namespace = “root\Microsoft\SqlServer\ComputerManagement16”

To validate which namespaces exist on the device and provide the correct MSSQL version:

Click Start and search for computer management.
Under Services and Application, select WMI Control.
Right click services and select security tab Namespace: root\Microsoft\SqlServer?
Please find the attached screenshot for your reference.

Prerequisites

Ensure that required WMI classes be available in system.

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Windows MSSQL Performance and Statistics	microsoft_windows_MSSQL_latchWaitsPerSec	Microsoft Windows MSSQL LatchWaits PerSec	Count per sec	Monitors the number of latch requests that could not be granted immediately and had to wait before being granted.
	microsoft_windows_MSSQL_averageLatchWaitTimems	Microsoft Windows MSSQL AverageLatchWaitTimems	ms	Monitors the average latch wait time (milliseconds) for latch requests that had to wait.
	microsoft_windows_MSSQL_dataFilesSizeKB	Microsoft Windows MSSQL DataFilesSizeKB	KB	Monitors the cumulative size of all the data files in the database.
	microsoft_windows_MSSQL_logFilesUsedSizeKB	Microsoft Windows MSSQL LogFilesUsedSizeKB	KB	Monitors the cumulative used size of all the log files in the database.
	microsoft_windows_MSSQL_logFlushesPersec	Microsoft Windows MSSQL LogFlushesPersec	Count per sec	Monitors the total number of log flushes.
	microsoft_windows_MSSQL_transactionsPersec	Microsoft Windows MSSQL TransactionsPersec	Count per sec	Monitors the total number of transactions started for the database
	microsoft_windows_MSSQL_lockTimeoutsPersec	Microsoft Windows MSSQL LockTimeoutsPersec	Count per sec	Monitors the number of lock requests that timed out. This includes requests for NOWAIT locks.
	microsoft_windows_MSSQL_numberofDeadlocksPersec	Microsoft Windows MSSQL NumberofDeadlocksPersec	Count per sec	Monitors the number of lock requests that resulted in a deadlock.
	microsoft_windows_MSSQL_averageWaitTimems	Microsoft Windows MSSQL AverageWaitTimems	ms	Monitors the total average amount of wait time (milliseconds) for each lock request that resulted in a wait.
	microsoft_windows_MSSQL_lockWaitsPersec	Microsoft Windows MSSQL LockWaitsPersec	Count per sec	Monitors the total number of lock requests that could not be satisfied immediately and required the caller to wait before being granted the lock.
	microsoft_windows_MSSQL_pagelifeexpectancy	Microsoft Windows MSSQL Pagelifeexpectancy	s	Monitors the number of seconds a page will stay in the buffer pool without references
	microsoft_windows_MSSQL_lazywritesPersec	Microsoft Windows MSSQL LazywritesPersec	Count per sec	Monitors the number of buffers written by buffer manager's lazy writer.
	microsoft_windows_MSSQL_pagereadsPersec	Microsoft Windows MSSQL PagereadsPersec	Count per sec	Monitors the number of physical database page reads issued.
	microsoft_windows_MSSQL_pagewritesPersec	Microsoft Windows MSSQL PagewritesPersec	Count per sec	Monitors the number of physical database page writes issued.
	microsoft_windows_MSSQL_checkpointpagesPersec	Microsoft Windows MSSQL CheckpointpagesPersec	Count per sec	Monitors the number of pages flushed by checkpoint or other operations that require all dirty pages to be flushed.
	microsoft_windows_MSSQL_connectionMemoryKB	Microsoft Windows MSSQL ConnectionMemoryKB	KB	Monitors the total amount of dynamic memory the server is using for maintaining connections.
	microsoft_windows_MSSQL_databaseCacheMemoryKB	Microsoft Windows MSSQL DatabaseCacheMemoryKB	KB	Monitors the amount of memory the server is currently using for the database cache.
	microsoft_windows_MSSQL_freeMemoryKB	Microsoft Windows MSSQL FreeMemoryKB	KB	Monitors the amount of memory the server is currently not using.
	microsoft_windows_MSSQL_lockMemoryKB	Microsoft Windows MSSQL LockMemoryKB	KB	Monitors the total amount of dynamic memory the server is using for locks.
	microsoft_windows_MSSQL_memoryGrantsPending	Microsoft Windows MSSQL MemoryGrantsPending	count	Monitors the current number of processes waiting for a workspace memory grant.
	microsoft_windows_MSSQL_optimizerMemoryKB	Microsoft Windows MSSQL OptimizerMemoryKB	KB	Monitors the total amount of dynamic memory the server is using for query optimization.
	microsoft_windows_MSSQL_totalServerMemoryKB	Microsoft Windows MSSQL TotalServerMemoryKB	KB	Monitors the total amount of dynamic memory the server is currently consuming.
	microsoft_windows_MSSQL_SQLCacheMemoryKB	Microsoft Windows MSSQL SQLCacheMemoryKB	KB	Monitors the total amount of dynamic memory the server is using for the dynamic SQL cache.
	microsoft_windows_MSSQL_forwardedRecordsPersec	Microsoft Windows MSSQL ForwardedRecordsPersec	Count per sec	Monitors the number of records fetched through forwarded record pointers.
	microsoft_windows_MSSQL_pageSplitsPersec	Microsoft Windows MSSQL PageSplitsPersec	Count per sec	Monitors the number of page splits per second that occur as a result of overflowing index pages.
	microsoft_windows_MSSQL_fullScansPersec	Microsoft Windows MSSQL FullScansPersec	Count per sec	Monitors the number of unrestricted full scans. These can either be base table or full index scans.
	microsoft_windows_MSSQL_processesBlocked	Microsoft Windows MSSQL ProcessesBlocked	count	Monitors the Number of currently blocked processes.
	microsoft_windows_MSSQL_userConnections	Microsoft Windows MSSQL UserConnections	count	Monitors the number of users connected to the system.
	microsoft_windows_MSSQL_loginsPersec	Microsoft Windows MSSQL LoginsPersec	Count per sec	Monitors the total number of logins started per second.
	microsoft_windows_MSSQL_logoutsPersec	Microsoft Windows MSSQL LogoutsPersec	Count per sec	Monitors the total number of logouts started per second.
	microsoft_windows_MSSQL_longestTransactionRunningTime	Microsoft Windows MSSQL LongestTransactionRunningTime	s	Monitors the longest running time of any transaction in seconds.
	microsoft_windows_MSSQL_receiveIPerOsPersec	Microsoft Windows MSSQL ReceiveIPerOsPersec	Count per sec	Monitors the number of transport receives I/O per second. Note that a transport receive I/O may contain more than one message fragment
	microsoft_windows_MSSQL_sendIPerOsPersec	Microsoft Windows MSSQL SendIPerOsPersec	Count per sec	Monitors the number of transport send I/Os per second. Note that a transport send I/O may contain more than one message fragment.
	microsoft_windows_MSSQL_openConnectionCount	Microsoft Windows MSSQL OpenConnectionCount	Count	Monitors the total number of transport connections currently open.
	microsoft_windows_MSSQL_SQLCompilationsPersec	Microsoft Windows MSSQL SQLCompilationsPersec	Count per sec	Monitors the number of SQL compilations.
	microsoft_windows_MSSQL_SQLReCompilationsPersec	Microsoft Windows MSSQL SQLReCompilationsPersec	Count per sec	Monitors the number of SQL re-compiles.
	microsoft_windows_MSSQL_batchRequestsPersec	Microsoft Windows MSSQL BatchRequestsPersec	Count per sec	Monitors the number of SQL batch requests received by server.
	microsoft_windows_MSSQL_taskLimitReached	Microsoft Windows MSSQL TaskLimitReached	count	Monitors the total number of times the activated task limit on a queue has been reached.
	microsoft_windows_MSSQL_tasksAbortedPersec	Microsoft Windows MSSQL TasksAbortedPersec	Count per sec	Monitors the number of activated tasks that are being aborted per second.
	microsoft_windows_MSSQL_SQLRECEIVEsPersec	Microsoft Windows MSSQL SQLRECEIVEsPersec	Count per sec	Monitors the number of SQL RECEIVE commands processed by the Broker per second.
	microsoft_windows_MSSQL_BrokerTransactionRollbacks	Microsoft Windows MSSQL BrokerTransactionRollbacks	count	Monitors the number of Service Broker related transactions that have rolled back.
	microsoft_windows_MSSQL_SQLSENDsPersec	Microsoft Windows MSSQL SQLSENDsPersec	Count per sec	Monitors the number of SQL SEND commands processed by the Broker per second.
	microsoft_windows_MSSQL_logBytesFlushedPersec	Microsoft Windows MSSQL LogBytesFlushedPersec	Bps	Monitors the total number of log bytes flushed.
	microsoft_windows_MSSQL_percentLogUsed	Microsoft Windows MSSQL PercentLogUsed	%	Monitors the percent of space in the log that is in use.
	microsoft_windows_MSSQL_logFilesSizeKB	Microsoft Windows MSSQL LogFilesSizeKB	KB	Monitors the cumulative size of all the log files in the database.
	microsoft_windows_MSSQL_logFlushWaitsPersec	Microsoft Windows MSSQL LogFlushWaitsPersec	Count per sec	Monitors the number of commits waiting on log flush.
	microsoft_windows_MSSQL_logGrowths	Microsoft Windows MSSQL LogGrowths	count	Monitors the total number of log growths for this database.
	microsoft_windows_MSSQL_logShrinks	Microsoft Windows MSSQL LogShrinks	count	Monitors the total number of log shrinks for this database.
	microsoft_windows_MSSQL_cacheHitRatioPercentage	Microsoft Windows MSSQL CacheHitRatio Percentage	%	Monitors the percentage of cache hits relative to cache lookups.
	microsoft_windows_MSSQL_bufferCacheHitRatioPercentage	Microsoft Windows MSSQL Buffercachehitratio Percentage	%	Monitors the percentage of pages that were found in the buffer pool without having to incur a read from disk.

Agent G2 - Microsoft Windows Sharepoint Performance Counters

Description

Microsoft Windows Sharepoint Performance Counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Windows Sharepoint Performance Counters	microsoft_windows_SharePointFoundation_ActiveHeapCount	Microsoft Windows SharePointFoundation ActiveHeapCount	count	The number of native heaps in use by the process
	microsoft_windows_sharepoint_SearchLinguistics_CompanyExclusionDictionaryEntries	Microsoft Windows SharePoint SearchLinguistics CompanyExclusionDictionaryEntries	count	Number of entries contained in the current exclusion dictionary for company extraction.
	microsoft_windows_SharePointServerCacheinstances_CacheHitRatio	Microsoft Windows SharePointServerCacheinstances CacheHitRatio	NULL	Cache hit ratio

Agent G2 - Microsoft Windows SMBServer Traffic

Description

To Monitor SMB Server Traffic, this Works in Windows OS Versions of 2016 and above

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
System Windows SMBServer Monitor	system_windows_smbserver_readbytespersec	System Windows SMBServer ReadBytesPerSec	Bps	The rate, in seconds, at which data is being read in this session.
System Windows SMBServer Monitor	system_windows_smbserver_writebytespersec	System Windows SMBServer WriteBytesPerSec	Bps	The rate, in seconds, at which data is being written in this session.

Agent G2 - Microsoft Windows SQL Counters

Description

Microsoft Windows SQL Counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Windows SQL Counters	microsoft_windows_SQLServerFileTable_AvgTimeDeleteFileTableItem	Microsoft Windows SQLServerFileTable AvgTimeDeleteFileTableItem	ms	Average time (in milliseconds) taken to delete a FileTable item.
	microsoft_windows_SharePointServerSearch_CountCommitTransactions	Microsoft Windows SharePointServerSearch CountCommitTransactions	count	Count Commit Transactions
	microsoft_windows_ReportServerService_ActiveConnections	Microsoft Windows ReportServerService ActiveConnections	count	Number of connections active against server.
	microsoft_windows_SQLServerSSISPipeline110_BLOBbytesread	Microsoft Windows SQLServerSSISPipeline110 BLOBbytesread	NULL	The number of bytes of binary large object (BLOB) data that the data flow engine has read from all sources.
	microsoft_windows_SQLAgentStats_SQLServerRestarted	microsoft_windows_SQLAgentStats_SQLServerRestarted	count	The number of times the SQL Server has been successfully restarted by SQL Server Agent, since the last SQL Server Agent restart.
	microsoft_windows_SQLServerBrokerTOStatistics_AvgLengthofBatchedWrites	Microsoft Windows SQLServerBrokerTOStatistics AvgLengthofBatchedWrites	NULL	Average Number of Transmission Objects saved in a batch.
	microsoft_windows_SQLAgentAlerts_Activatedalerts	Microsoft Windows SQLAgentAlerts Activatedalerts	count	The number of Alerts that have activated since the last SQL Server restart.
	microsoft_windows_SQLServerQueryExecution_LocalDataAccessPersec	Microsoft Windows SQLServerQueryExecution LocalDataAccessPersec	count	Total number of local data access per second

Agent G2 - Microsoft Windows W3SVC Counters

Description

Microsoft Windows W3SVC Counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Windows W3SVC Counters	microsoft_windows_W3SVC_WebService_ConnectionAttemptsPersec	Microsoft Windows W3SVC WebService ConnectionAttemptsPersec	NULL	The rate that connections to the Web service are being attempted.
Agent G2 - Microsoft Windows W3SVC Counters	microsoft_windows_W3SVCW3WP_ActiveFlushedEntries	Microsoft Windows W3SVCW3WP ActiveFlushedEntries	count	Number of file handles cached in user-mode that will be closed when all current transfers complete.

Agent G2 - Microsoft Windows WAS Counters

Description

Microsoft Windows WAS Counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Windows WAS Counters	microsoft_windows_WASW3WP_ActiveListenerChannels	Microsoft Windows WASW3WP ActiveListenerChannels	count	Number of currently active listener channels in the worker process.

Agent G2 - Microsoft Windows WFP Performance Counters

Description

Microsoft Windows WFP Performance Counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Windows WFP Performance Counters	microsoft_windows_WFP_ProviderCount	Microsoft Windows WFP ProviderCount	count	Provider Count is the number of providers registered with the Windows Filtering Platform.
	microsoft_windows_WFPv4_ActiveInboundConnections	Microsoft Windows WFPv4 ActiveInboundConnections	count	Active Inbound Connections is the number of current inbound connections allowed by the Windows Filtering Platform.
	microsoft_windows_WFPv6_ActiveInboundConnections	Microsoft Windows WFPv6 ActiveInboundConnections	count	Active Inbound Connections is the number of current inbound connections allowed by the Windows Filtering Platform.

Agent G2 - MountPoints Instance DotNet v4

Description

Provide the parameters for both the monitors like below: (Instance Name means ‘Caption Name’ of mounted disk) InstanceName1,Warning,Critical^InstanceName2,warning,Critical^InstanceName3,Warning,Critical

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - MountPoints Instance DotNet v4	mounted.disks.freespace	Mounted Disks FreeSpace	NULL	Shows the free space of mounted disks in MB
Agent G2 - MountPoints Instance DotNet v4	mounted.disks.utilization	Mounted Disks Utilization	%	Shows the utilization space of mounted disks in percentage

Agent G2 - MSExchange 2016 Extended DotNet v4

Description

Monitor MSExchange 2016 metric like MSExchange 2016 IO Log Writes Average Latency, MSExchange 2016 IO Database Reads Recovery Average Latency, MSExchange 2016 IO Database Writes Recovery Average Latency, MSExchange 2016 ActiveManager DatabaseMounted, MSExchange 2016 ActiveSync PingCommandsPending, MSExchange 2016 OWA CurrentUniqueUsers, MSExchange 2016 Autodiscover RequestsPerSec, MSExchange 2016 OtherRequestMethodsPerSec

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - MSExchange 2016 Extended DotNet v4	msexchange2016_IOLogWritesAverageLatency	MSExchange 2016 IO Log Writes Average Latency	Milliseconds	IO Log Writes Average Latency is the average length of time, in milliseconds, per log file write operation.
	msexchange2016_IODatabaseReadsRecoveryAverageLatency	MSExchange 2016 IO Database Reads Recovery Average Latency	Milliseconds	IO Database Reads (Recovery) Average Latency is the average length of time, in milliseconds, per database read operation.
	msexchange2016_ActiveSync_PingCommandsPending	MSExchange 2016 ActiveSync PingCommandsPending	Count	Ping Commands Pending is the number of Ping commands that are currently pending on the server.
	msexchange2016_IODatabaseWritesRecoveryAverageLatency	MSExchange 2016 IO Database Writes Recovery Average Latency	Milliseconds	IO Database Writes (Recovery) Average Latency is the average length of time, in milliseconds, per database write operation.
	msexchange2016_OtherRequestMethodsPersec	MSExchange 2016 OtherRequestMethodsPerSec	NULL	The rate HTTP requests are made that do not use the OPTIONS, GET, HEAD, POST, PUT, DELETE, TRACE, MOVE, COPY, MKCOL, PROPFIND, PROPPATCH, SEARCH, LOCK or UNLOCK methods.
	msexchange2016_ActiveManager_DatabaseMounted	MSExchange 2016 ActiveManager DatabaseMounted	Count	Shows the number of active database copies on the server.
	msexchange2016_OWA_CurrentUniqueUsers	MSExchange 2016 OWA CurrentUniqueUsers	Count	Current Unique Users is the number of unique users currently signed in to Outlook Web App. This value monitors the number of unique active user sessions, so that users are only removed from this count after they sign out or their session times out.
	msexchange2016_Autodiscover_RequestsPersec	MSExchange 2016 Autodiscover RequestsPerSec	Requests Per Sec	Requests Per sec is the number of Autodiscover requests that are processed each second.

Agent G2 - MSExchange CAS Performance Counters DotNet v4

Description

Monitors MSExchange CAS Performance Counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - MSExchange CAS Performance Counters DotNet v4	rpcclientaccess.activeusercount	MSExchange RpcClientAccess ActiveUserCount	NULL	Active User Count is the number of unique users that have shown some activity in the last 2 minutes.
	rpcclientaccess.rpcaveragedlatency	MSExchange RpcClientAccess RpcAveragedLatency	MS	RPC Averaged Latency is the latency, in milliseconds, averaged for the past 1024 packets.
	autodiscover.requestspersec	MSExchange Autodiscover RequestsPerSec	NULL	Requests/sec is the number of Autodiscover requests that are processed each second.

Agent G2 - MSExchange Message Queue Monitoring - Powershell

Description

Monitors MSExchange Message Queue data using powershell command lets

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - MSExchange Message Queue Monitoring - Powershell	SuspendedMessages	SuspendedMessages	NULL	The messages that have been suspended and these messages will not be processed further till the administrator resumes the messages.
	ActiveMessages	ActiveMessages	NULL	The messages in the delivery queue that are being delivered to the next hop mail server.
	ReadyMessages	ReadyMessages	NULL	The messages that are waiting to be processed.
	DelayedMessages	DelayedMessages	NULL	The Messages that could not be delivered the last time it tried. Exchange will try to deliver the messages again if the retry counter does not expire.

Agent G2 - MSLync Performance Counters DotNet v4

Description

Monitors Microsoft Lync Performance counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - MSLync Performance Counters DotNet v4	msmqservice.msmq.outgoing.messages	MSMQService MSMQOutgoingMessages	NULL	The total number of outgoing Message Queuing messages sent from the selected computer by the Message Queuing service
	msmqservice.outgoing.messages.per.sec	MSMQService OutgoingMessagesPerSec	NULL	The rate at which outgoing Message Queuing messages are sent from the selected computer by the Message Queuing service
	msmqservice.total.messages.in.all.queues	MSMQService Totalmessagesinallqueues	NULL	The total number of Message Queuing messages residing in active queues on the selected computer
	msmqservice.ip.sessions	MSMQService IPSessions	NULL	The number of open IP sessions involving the selected computer
	msmqservice.incoming.multicast.sessions	MSMQService IncomingMulticastSessions	NULL	The number of open incoming multicast sessions involving the selected computer
	msmqservice.total.bytes.in.all.queues	MSMQService Totalbytesinallqueues	NULL	The total number of bytes in all Message Queuing messages residing in active queues on the selected computer
	msmqservice.sessions	MSMQService Sessions	NULL	The number of open IP sessions involving the selected computer
	msmqservice.msmq.incoming.messages	MSMQService MSMQIncomingMessages	NULL	The total number of incoming Message Queuing messages placed in queues on the selected computer by the Message Queuing service
	msmqservice.outgoing.http.sessions	MSMQService OutgoingHTTPSessions	NULL	The number of open outgoing HTTP sessions involving the selected computer
	msmqservice.incoming.messages.per.sec	MSMQService IncomingMessagesPerSec	NULL	The rate at which incoming Message Queuing messages are placed in queues on the selected computer by the Message Queuing service
	msmqservice.outgoing.multicast.sessions	MSMQService OutgoingMulticastSessions	NULL	The number of open outgoing multicast sessions involving the selected computer

Agent G2 - MSSQL - Data and Log Space Size - Config Parameters DotNet v4

Description

MSSQL_Data_Log_Space. Monitor SQL db data-space and log-space by providing the SQL db credentials from portal. No need to create any credentials file in the target device for this template.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - MSSQL - Data and Log Space Size - Config Parameters DotNet v4	mssql.data.space.free	MSSQL Data Space Free	%	This monitor checks the amount of free space available in the data files(.mdf) for the selected databases. It creates an alert when the percent free space available is lesser than the configured threshold
	mssql.log.space.free	MSSQL Log Space Free	%	This monitor checks the amount of free space available in the transaction log files(.ldf) for the selected databases. It creates an alert when the percent free space available is lesser than the configured threshold

Agent G2 - MSSQL Performance Monitoring DotNet v4

Description

Monitors MSSQL WMI Performance Metrics

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - MSSQL Performance Monitoring DotNet v4	mssql.batch.requests.per.sec	MSSQL BatchRequestsPerSec	NULL	Number of SQL batch requests received by server.
	mssql.processes.blocked	MSSQL ProcessesBlocked	NULL	Number of currently blocked processes.
	mssql.checkpoint.pages.per.sec	MSSQL CheckPointPagesPerSec	NULL	Number of pages flushed by checkpoint or other operations that require all dirty pages to be flushed.
	mssql.lock.waits.per.sec	MSSQL LockWaitsPerSec	NULL	Number of lock requests that could not be satisfied immediately and required the caller to wait before being granted the lock.
	mssql.page.life.expectancy	MSSQL PageLifeExpectancy	NULL	Number of seconds a page will stay in the buffer pool without references.
	mssql.page.splits.per.sec	MSSQL PageSplitsPerSec	NULL	Number of page splits per second that occur as the result of overflowing index pages.

Agent G2 - MSSQL Thread Count Free DotNet v4

Description

Displays the available MSSQL Free Thread Count. SQLFreeThreadCount is calculated from max_worker_threads - Currently Active Threads. If max_worker_threads is not provided in the param, it will be the default configured value.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - MSSQL Thread Count Free DotNet v4	mssql.thread.count.free	MSSQL Thread Count Free	NULL	Shows the available SQL Free Thread Count. SQLFreeThreadCount is calculated from max_worker_threads - Currently Active Threads. \nIf max_worker_threads is not provided in the param, it will be the default configured value.

Agent G2 - MySQL Global Monitors

Description

Template to monitor My SQL Server. Monitors the global windows monitors like Binlog cache disk status, cache use, bytes sent, bytes received, etc.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - MySQL Global Monitors	MySQL_Bytes_Received	MySQL Bytes Received	NULL	The number of bytes received from all clients.
	MySQL_Command_Delete	MySQL Command Delete	NULL	Number of times Delete has executed.
	MySQL_Handler_Read_First	MySQL Handler Read First	NULL	The number of times the first entry in an index was read.
	MySQL_Command_Insert_Select	MySQL Command Insert Select	NULL	Number of times insert select has executed.
	MySQL_Questions	MySQL Questions	NULL	The number of statements executed by the server.
	MySQL_Open_Table_Definitions	MySQL Open Table Definitions	NULL	The number of cached .frm files.
	MySQL_Sort_Rows	MySQL Sort Rows	NULL	The number of sorted rows.
	MySQL_Command_Call_Procedure	MySQL Command Call Procedure	NULL	Number of times call procedure has executed.
	MySQL_Opened_Tables	MySQL Opened Tables	NULL	The number of tables that have been opened.
	MySQL_Created_Temporary_Disk_Tables	MySQL Created Temporary Disk Tables	NULL	The number of internal on-disk temporary tables created by the server while executing statements.
	MySQL_Handler_Read_Previous	MySQL Handler Read Previous	NULL	The number of requests to read the previous row in key order.
	MySQL_Command_Insert	MySQL Command Insert	NULL	Number of times Insert has executed.
	MySQL_Handler_Read_Ramdom_Next	MySQL Handler Read Ramdom Next	NULL	The number of requests to read the next row in the data file.
	MySQL_Handler_Delete	MySQL Handler Delete	NULL	The number of times that rows have been deleted from tables.
	MySQL_Open_Tables	MySQL Open Tables	NULL	The number of tables that are open.
	MySQL_Bytes_Sent	MySQL Bytes Sent	NULL	The number of bytes sent to all clients.
	MySQL_Binlog_Cache_Use	MySQL Binlog Cache Use	NULL	The number of transactions that used the temporary binary log cache.
	MySQL_Created_Temporary_Tables	MySQL Created Temporary Tables	NULL	The number of internal temporary tables created by the server while executing statements.
	MySQL_Sort_Merge_Passes	MySQL Sort Merge Passes	NULL	The number of merge passes that the sort algorithm has had to do.
	MySQL_Sort_Range	MySQL Sort Range	NULL	The number of sorts that were done using ranges.
	MySQL_Table_Locks_Immediate	MySQL Table Locks Immediate	NULL	The number of times that a request for a table lock could be granted immediately.
	MySQL_Uptime	MySQL Uptime	NULL	The number of seconds that the server has been up.
	MySQL_Sort_Scan	MySQL Sort Scan	NULL	The number of sorts that were done by scanning the table.
	MySQL_Slow_Queries	MySQL Slow Queries	NULL	The number of queries that have taken more than long_query_time seconds.
	MySQL_Command_Replace	MySQL Command Replace	NULL	Number of times replace has executed.
	MySQL_Handler_Read_Random	MySQL Handler Read Random	NULL	The number of requests to read a row based on a fixed position.
	MySQL_Created_Temporary_Files	MySQL Created Temporary Files	NULL	How many temporary files mysqld has created.
	MySQL_Binlog_Cache_Disk_Use	MySQL Binlog Cache Disk Use	NULL	The number of transactions that used the temporary binary log cache.
	MySQL_Command_Delete_Multi	MySQL Command Delete Multi	NULL	Number of times Delete has executed.
	MySQL_Handler_Update	MySQL Handler Update	NULL	The number of requests to update a row in a table.
	MySQL_Command_Replace_Select	MySQL Command Replace Select	NULL	Number of times replace select has executed.
	MySQL_Command_Select	MySQL Command Select	NULL	Number of times select has executed.
	MySQL_Handler_Read_Key	MySQL Handler Read Key	NULL	The number of requests to read a row based on a key.
	MySQL_Opened_Files	MySQL Opened Files	NULL	The number of files that have been opened.
	MySQL_Opened_Table_Definitions	MySQL Opened Table Definitions	NULL	The number of .frm files that have been cached.
	MySQL_Command_Update_Multi	MySQL Command Update Multi	NULL	Number of times update multiple has executed.
	MySQL_Handler_Write	MySQL Handler Write	NULL	The number of requests to insert a row in a table.
	MySQL_Command_Update	MySQL Command Update	NULL	Number of times update has executed.
	MySQL_Handler_Read_Next	MySQL Handler Read Next	NULL	The number of requests to read the next row in key order.
	MySQL_Table_Locks_Waited	MySQL Table Locks Waited	NULL	The number of times that a request for a table lock could not be granted immediately and a wait was needed.

Agent G2 - MySQL InnoDB Monitors

Description

Template for My SQL InnoDB monitors. Monitors InnoDB buffer pool pages data, buffer pool pages dirty, buffer pool pages flushed, etc.

Prerequisites

NULL

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - MySQL InnoDB Monitors	MySQL_Innodb_Data_Written	MySQL InnoDB Data Written	NULL	The amount of data written so far, in bytes.
	MySQL_Innodb_Data_Writes	MySQL InnoDB Data Writes	NULL	The total number of data writes.
	MySQL_Innodb_Buffer_Pool_Pages_Total	MySQL InnoDB Buffer Pool Pages Total	NULL	The total size of buffer pool, in pages.
	MySQL_Innodb_Buffer_Pool_Pages_Data	MySQL InnoDB Buffer Pool Pages Data	NULL	The number of pages containing data (dirty or clean).
	MySQL_Innodb_Buffer_Pool_Reads	MySQL InnoDB Buffer Pool Reads	NULL	The number of logical reads that InnoDB could not satisfy from the buffer pool, and had to read directly from the disk.
	MySQL_Innodb_Buffer_Pool_Pages_Free	MySQL InnoDB Buffer Pool Pages Free	NULL	The number of free pages.
	MySQL_Innodb_Flush_Log_At_Transaction_Commit	MySQL InnoDB Flush Log At Transaction Commit	NULL	The log buffer is written out to the log file once per second and the flush to disk operation is performed on the log file, but nothing is done at a transaction commit.
	MySQL_Innodb_Force_Recovery	MySQL InnoDB Force Recovery	NULL	The crash recovery mode.
	MySQL_Innodb_Buffer_Pool_Pages_Dirty	MySQL InnoDB Buffer Pool Pages Dirty	NULL	The number of pages currently dirty.
	MySQL_Innodb_Buffer_Pool_Size	MySQL InnoDB Buffer Pool Size	NULL	The size in bytes of the memory buffer InnoDB uses to cache data and indexes of its tables.
	MySQL_Innodb_Data_Reads	MySQL InnoDB Data Reads	NULL	The total number of data reads.
	MySQL_Innodb_Log_File_Size	MySQL InnoDB Log File Size	NULL	The size in bytes of each log file in a log group.
	MySQL_Innodb_Data_Fsyncs	MySQL InnoDB Data Fsyncs	NULL	The number of fsync() operations so far.
	MySQL_Innodb_Log_Buffer_Size	MySQL InnoDB Log Buffer Size	NULL	The size in bytes of the buffer that InnoDB uses to write to the log files on disk.
	MySQL_Innodb_Row_Lock_Waits	MySQL InnoDB Row Lock Waits	NULL	The number of times a row lock had to be waited for.
	MySQL_Innodb_Row_Lock_Time	MySQL InnoDB Row Lock Time	NULL	The total time spent in acquiring row locks, in milliseconds.
	MySQL_Innodb_Data_Read	MySQL InnoDB Data Read	NULL	The amount of data read since the server was started.
	MySQL_Innodb_Buffer_Pool_Read_Requests	MySQL InnoDB Buffer Pool Read Requests	NULL	The number of logical read requests.
	MySQL_Innodb_Buffer_Pool_Pages_Miscellaneous	MySQL InnoDB Buffer Pool Pages Miscellaneous	NULL	The number of pages that are busy because they have been allocated for administrative overhead such as row locks or the adaptive hash index.
	MySQL_Innodb_Buffer_Pool_Pages_Flushed	MySQL InnoDB Buffer Pool Pages Flushed	NULL	The number of buffer pool page-flush requests.

Agent G2 - MySQL Variable Monitors

Description

Template for My SQL Variable monitors. Monitors aborted clients, aborted connects, log warnings, etc.

Prerequisites

NULL

MySQL Variable Monitors

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - MySQL Variable Monitors	MySQL_Threads_Created	MySQL Threads Created	NULL	The number of threads created to handle connections.
	MySQL_Qcache_LowMemory_Prunes	MySQL Query Cache Low Memory Prunes	NULL	The number of queries that were deleted from the query cache because of low memory.
	MySQL_Qcache_Free_Blocks	MySQL Query Cache Free Blocks	NULL	The number of free memory blocks in the query cache.
	MySQL_Threads_Connected	MySQL Threads Connected	NULL	The number of currently open connections.
	MySQL_Table_Open_Cache	MySQL Table Open Cache	NULL	The number of open tables for all threads.
	MySQL_Temporary_Table_Size	MySQL Temporary Table Size	NULL	The maximum size of internal in-memory temporary tables. (The actual limit is determined as the minimum of tmp_table_size and max_heap_table_size.)
	MySQL_Aborted_Connects	MySQL Aborted Connects	NULL	The number of failed attempts to connect to the MySQL server.
	MySQL_Threads_Running	MySQL Threads Running	NULL	The number of threads that are not sleeping.
	MySQL_Max_User_Connections	MySQL Max User Connections	NULL	The maximum number of simultaneous connections permitted to any given MySQL user account.
	MySQL_Foreign_Key_Checks	MySQL Foreign Key Checks	NULL	It will check the foreign key constraints.
	MySQL_Aborted_Clients	MySQL Aborted Clients	NULL	The number of connections that were aborted because the client died without closing the connection properly.
	MySQL_Qcache_Total_Blocks	MySQL Query Cache Total Blocks	NULL	The total number of blocks in the query cache.
	MySQL_Qcache_Not_Cached	MySQL Query Cache Not Cached	NULL	The number of noncached queries.
	MySQL_Qcache_Inserts	MySQL Query Cache Inserts	NULL	The number of queries added to the query cache.
	MySQL_Qcache_Hits	MySQL Query Cache Hits	NULL	The number of query cache hits.
	MySQL_Long_Query_Time	MySQL Long Query Time	NULL	If a query takes longer than this many seconds, the server increments the Slow_queries status variable. If the slow query log is enabled, the query is logged to the slow query log file. This value is measured in real time, not CPU time, so a query that is under the threshold on a lightly loaded system might be above the threshold on a heavily loaded one.
	MySQL_Table_Definition_Cache	MySQL Table Definition Cache	NULL	The number of table definitions (from .frm files) that can be stored in the definition cache.
	MySQL_Qcache_Free_Memory	MySQL Query Cache Free Memory	NULL	The amount of free memory for the query cache.
	MySQL_Query_Cache_Size	MySQL Query Cache Size	NULL	The amount of memory allocated for caching query results.
	MySQL_Log_Warnings	MySQL Log Warnings	NULL	Print out warnings to log file.
	MySQL_Thread_Cache_Size	MySQL Thread Cache Size	NULL	How many threads the server should cache for reuse.
	MySQL_Threads_Cached	MySQL Threads Cached	NULL	The number of threads in the thread cache.
	MySQL_Max_Heap_Table_Size	MySQL Max Heap Table Size	NULL	This variable sets the maximum size to which user-created MEMORY tables are permitted to grow.
	MySQL_Qcache_Queries_In_Cache	MySQL Query Cache Queries In Cache	NULL	The number of queries registered in the query cache.
	MySQL_Max_Used_Connections	MySQL Max Used Connections	NULL	The maximum number of connections that have been in use simultaneously since the server started.
	MySQL_Thread_Stack	MySQL Thread Stack	NULL	The stack size for each thread.

Agent G2 - Netlogon Performance Counters DotNet v4

Description

Monitors Netlogon Performance Counters like Average Semaphore Hold Time, Semaphore Timeouts

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Netlogon Performance Counters DotNet v4	AverageSemaphoreHoldTime	Average Semaphore Hold Time	NULL	Each time the semaphore is acquired the timer is started and when it is released it is stopped. This value is taken and divided by the total number of times the semaphore has been acquired in order to provide the average number of the hold time in seconds.
Agent G2 - Netlogon Performance Counters DotNet v4	SemaphoreTimeouts	Semaphore Timeouts	NULL	This counter tracks the total number of threads that have timed out while waiting to acquire the semaphore for this Secure Channel since the last time it connected.

Agent G2 - Network Interface Monitoring - DotNet v4

Description

Monitors Network Interface monitoring metrics like Interface Traffic In, Traffic Out, Utilization

Prerequisites

NULL

Network Interface Monitoring

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Network Interface Monitoring - DotNet v4	tcpip.network.interface.traffic.out	tcpip.network.interface.traffic.out	Bps	Monitors TCPIP Network Interface Traffic Out
	tcpip.network.interface.traffic.in	tcpip.network.interface.traffic.in	Bps	Monitors TCIP Network Interface Traffic In
	tcpip.network.interface.utilization	tcpip.network.interface.utilization	%	Monitors Network Interface Utilization in percentage

Agent G2 - Operating System Performance Counters DotNet v4

Description

Monitors Operating System Performance Counters

Prerequisites

NULL

Operating System Performance Counters

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Operating System Performance Counters DotNet v4	processor.percent.dpc.time	Processor Percent DPC Time	%	% DPC Time is the percentage of time that the processor spent receiving and servicing deferred procedure calls (DPCs) during the sample interval. DPCs are interrupts that run at a lower priority than standard interrupts. % DPC Time is a component of % Privileged Time because DPCs are executed in privileged mode. They are counted separately and are not a component of the interrupt counters. This counter displays the average busy time as a percentage of the sample time.
	processor.percent.privileged.time	Processor Percent Privileged Time	%	Shows the percentage of processor time that is spent in privileged mode. Privileged mode is a processing mode designed for operating system components and hardware-manipulating drivers. It allows direct access to hardware and all memory.
	system.processor.queue.length	System Processor Queue Length	NULL	Processor Queue Length can be used to identify if processor contention or high CPU utilization is caused by the processor capacity being insufficient to handle the workloads assigned to it. Processor Queue Length shows the number of threads that are delayed in the Processor Ready Queue and are waiting to be scheduled for execution. The value listed is the last observed value at the time the measurement was taken.
	processor.percent.user.time	Processor Percent User Time	%	The percentage of time a process was running in user mode. User mode is a restricted processing mode designed for applications, environment subsystems, and integral subsystems.
	processor.percent.processor.time	Processor Percent Processor Time	%	Shows the percentage of time that the processor is executing application or operating system processes. This is when the processor is not idle.
	process.percent.processor.time	Process Percent Processor Time	%	Shows the percentage of elapsed processor time that all process threads used to execute instructions. An instruction is the basic unit of execution in a computer; a thread is the object that executes instructions; and a process is the object created when a program is run. Code executed to handle some hardware interruptions and trap conditions are included in this count.

Agent G2 - Oracle Monitors Through Configuration Parameters DotNet v4

Description

Monitors oracle performance counters. Pass the below arguments to the script while applying the template in device level: Oracledbusername,Oracledbpassword,Oracledbhost,Oracledbport,Oracledbsid

Prerequisites

NULL

Oracle Monitors Through Configuration Parameters

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Oracle Monitors Through Configuration Parameters DotNet v4	oracle.sessions	Oracle Sessions	NULL	Validates how many sessions currently on a particular database.
	oracle.library.cache.reloads	Oracle Library Cache Reloads	NULL	Validates the Number of Library Cache Reloads by the database.
	oracle.table.scan.blocks	Oracle Table Scan Blocks	NULL	Number of blocks received via table scans.
	oracle_User.roll.backs	Oracle User Rollbacks	NULL	This metric represents the number of times, per transaction during the sample period, that users manually issue the ROLLBACK statement or an error occurred during a user's transactions.
	oracle.table.space.free	Oracle Table Space Free	NULL	Validates the Size allocated for the table by the database.
	oracle.data.file.size.allocated	Oracle Data File Size Allocated	NULL	Validates the Data File Size Allocated for the database.
	oracle.library.cache.gets	Oracle Library Cache Gets	NULL	Validates the Number of Library Cache gets by the database.
	oracle.cache.invalidations	Oracle Cache Invalidations	NULL	Validates how many Cache invalidations on a particular database.
	oracle.data.file.disk.reads	Oracle Data File Disk Reads	NULL	Validates the Number of Data file disk reads by the database.
	oracle.users.commit	Oracle Users Commit	NULL	Validates Number of User commits.
	oracle.data.file.disk.writes	Oracle Data File Disk Writes	NULL	Validates the Number of Data file disk writes to the database.
	oracle.processes	Oracle Processes	NULL	Validates how many processes on a particular database.
	oracle.long.running.queries	Oracle Long Running Queries	NULL	Validates how many long-running queries on a particular database.
	oracle.blocking.lock.queries	Oracle Blocking Lock Queries	NULL	Validates how many block lock queries on a particular database.
	oracle.table.space.allocated	Oracle Table Space Allocated	NULL	Validates the Size allocated for the table by the database.

Agent G2 - Physical Disk Storage Monitors DotNet v4

Description

Monitors Storage_CurrentDiskQueueLength, Storage_DiskBytesPersec, Storage_DiskTransfersPersec

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Physical Disk Storage Monitors DotNet v4	Storage_DiskBytesPersec	Storage_DiskBytesPersec	NULL	Disk Bytes/sec is the rate bytes are transferred to or from the disk during write or read operations.
	Storage_CurrentDiskQueueLength	Storage_CurrentDiskQueueLength	NULL	Current Disk Queue Length is the number of requests outstanding on the disk at the time the performance data is collected. It also includes requests in service at the time of the collection. This is a instantaneous snapshot, not an average over the time interval. Multi-spindle disk devices can have multiple requests that are active at one time, but other concurrent requests are awaiting service. This counter might reflect a transitory high or low queue length, but if there is a sustained load on the disk drive, it is likely that this will be consistently high. Requests experience delays proportional to the length of this queue minus the number of spindles on the disks. For good performance, this difference should average less than two.
	Storage_DiskTransfersPersec	Storage_DiskTransfersPersec	NULL	Disk Transfers/sec is the rate of read and write operations on the disk.

Agent G2 - Symantec Backup 2010 - Performance Counters DotNet v4

Description

Template for Symantec Backup Exec - 2010

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Symantec Backup 2010 - Performance Counters DotNet v4	ServerActiveTime	ServerActiveTime	NULL	The number of seconds the Backup Exec Engine Service has been active (one or more jobs running) since it last started.
	ActiveJobCount	ActiveJobCount	NULL	The number of jobs currently active (running or pending) in the Backup Exec Engine Service.
	BackupDeviceWaitTime	BackupDeviceWaitTime	Seconds	The total time (in seconds) all backup jobs have spent waiting for a storage device since the Backup Exec Engine Service last started.
	TPWorkItemProcessRate	TPWorkItemProcessRate	NULL	Rate at which the general thread pool is processing work items.
	JMJobCompletionRate	JMJobCompletionRate	NULL	The rate at which job completions are processed.
	AbortedJobs	AbortedJobs	NULL	The number of jobs that have been aborted since the Backup Exec Engine Service last started.
	TPCurrentlyQueuedWorkItems	TPCurrentlyQueuedWorkItems	NULL	The number of work items currently queued to the general thread pool.
	FailedJobs	FailedJobs	NULL	The number of jobs that have failed since the Backup Exec Engine Service last started.
	DeviceWaitTime	DeviceWaitTime	Seconds	The total time (in seconds) all jobs have spent waiting for a storage device since the Backup Exec Engine Service last started.
	TPWorkerPoolThreadCount	TPWorkerPoolThreadCount	NULL	The number of threads currently allocated to the general thread pool.
	JMReadyJobCount	JMReadyJobCount	NULL	The number of jobs that are ready and waiting for dispatch.

Agent G2 - System Performance Counters - Extended DotNet v4

Description

Monitor System Performance Counters using WMI classes

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - System Performance Counters - Extended DotNet v4	processor.interrupts.per.sec	Processor InterruptsPersec	NULL	Displays the number of device interrupts encountered by the processor per second.
	networkinterface.kb.received.per.sec	NetworkInterface KBReceivedPersec	NULL	Displays the number of kilobytes transferred in from a network interface per second.
	networkinterface.kb.sent.per.sec	NetworkInterface KBSentPersec	NULL	Displays the number of kilobytes transferred out of a network interface per second.
	logicaldisk.percentidletime	LogicalDiskPercentIdleTime	%	% Idle Time reports the percentage of time during the sample interval that the disk was idle.
	system.percent.registry.quota.in.use	System PercentRegistryQuotaInUse	%	Displays the length of the processor queue in number of threads.
	process.handle.count	Process HandleCount	NULL	Displays the number of handles associated with a process.
	memory.pages.output.per.sec	Memory PagesOutputPersec	NULL	Displays a count of the number of pages written to disk because the pages have been modified in main memory.
	memory.pages.input.per.sec	Memory PagesInputPersec	NULL	Displays the number of pages read from the disk to resolve memory references to pages that were not in memory at the time of the reference.
	process.working.set.size.kb	Process WorkingSetSizeKB	NULL	Displays the working set size (in kilobytes) used by the process during the polling cycle.
	memory.pool.nonpaged.bytes	Memory PoolNonpagedBytes	NULL	Pool Nonpaged Bytes is the size, in bytes, of the nonpaged pool, an area of the system virtual memory that is used for objects that cannot be written to disk, but must remain in physical memory as long as they are allocated.
	networkinterface.packets.per.sec	NetworkInterface PacketsPersec	NULL	Packets/sec is the rate at which packets are sent and received on the network interface.
	memory.pool.paged.bytes	Memory PoolPagedBytes	NULL	Pool Paged Bytes is the size, in bytes, of the paged pool, an area of the system virtual memory that is used for objects that can be written to disk when they are not being used.
	networkinterface.kb.total.per.sec	NetworkInterface KBTotalPersec	NULL	Displays the rate at which kilobytes are sent and received on the interface. This rate includes framing characters.
	processor.idle.time.percent	Processor IdleTimePercent	%	% Idle Time is the percentage of time the processor is idle during the sample interval.

Agent G2 - System Performance Counters DotNet v4

Description

Monitors System related performance counters

Prerequisites

NULL

System Performance Counters

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - System Performance Counters DotNet v4	processor.idle.time.percent	Processor IdleTimePercent	%	% Idle Time is the percentage of time the processor is idle during the sample interval.
	process.working.set.size.kb	Process WorkingSetSizeKB	NULL	Displays the working set size (in kilobytes) used by the process during the polling cycle.
	process.handle.count	Process HandleCount	NULL	Displays the number of handles associated with a process.
	processor.interrupts.per.sec	Processor InterruptsPersec	NULL	Displays the number of device interrupts encountered by the processor per second.
	networkinterface.kb.sent.per.sec	NetworkInterface KBSentPersec	NULL	Displays the number of kilobytes transferred out of a network interface per second.
	memory.pool.paged.bytes	Memory PoolPagedBytes	NULL	Pool Paged Bytes is the size, in bytes, of the paged pool, an area of the system virtual memory that is used for objects that can be written to disk when they are not being used.
	networkinterface.kb.received.per.sec	NetworkInterface KBReceivedPersec	NULL	Displays the number of kilobytes transferred in from a network interface per second.
	memory.pool.nonpaged.bytes	Memory PoolNonpagedBytes	NULL	Pool Nonpaged Bytes is the size, in bytes, of the nonpaged pool, an area of the system virtual memory that is used for objects that cannot be written to disk, but must remain in physical memory as long as they are allocated.
	networkinterface.packets.per.sec	NetworkInterface PacketsPersec	NULL	Packets/sec is the rate at which packets are sent and received on the network interface.
	memory.pages.input.per.sec	Memory PagesInputPersec	NULL	Displays the number of pages read from the disk to resolve memory references to pages that were not in memory at the time of the reference.
	memory.pages.output.per.sec	Memory PagesOutputPersec	NULL	Displays a count of the number of pages written to disk because the pages have been modified in main memory.
	logicaldisk.percentidletime	LogicalDiskPercentIdleTime	%	% Idle Time reports the percentage of time during the sample interval that the disk was idle.
	system.percent.registry.quota.in.use	System PercentRegistryQuotaInUse	%	Displays the length of the processor queue in number of threads.
	networkinterface.kb.total.per.sec	NetworkInterface KBTotalPersec	NULL	Displays the rate at which kilobytes are sent and received on the interface. This rate includes framing characters.

Agent G2 - TCPIP TCPv6 Performance Counters DotNet v4

Description

Monitors TCPIP TCPv4 Performance Counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - TCPIP TCPv4 Performance Counters DotNet v4	tcpip.tcpv4.connections.reset	Tcpip TCPv4 Connections Reset	NULL	Connections Reset is the number of times TCP connections have made a direct transition to the CLOSED state from either the ESTABLISHED state or the CLOSE-WAIT state.
	tcpip.tcpv4.connection.failures	Tcpip TCPv4 Connection Failures	NULL	Connection Failures is the number of times TCP connections have made a direct transition to the CLOSED state from the SYN-SENT state or the SYN-RCVD state, plus the number of times TCP connections have made a direct transition to the LISTEN state from the
	tcpip_tcpv6_ConnectionsReset	Tcpip TCPv6 Connections Reset	Count	Connections Reset is the number of times TCP connections have made a direct transition to the CLOSED state from either the ESTABLISHED state or the CLOSE-WAIT state.
	tcpip_tcpv6_ConnectionFailures	Tcpip TCPv6 Connection Failures	Count	Connection Failures is the number of times TCP connections have made a direct transition to the CLOSED state from the SYN-SENT state or the SYN-RCVD state, plus the number of times TCP connections have made a direct transition to the LISTEN state from the SYN-RCVD state.

Agent G2 - URI Performance Counters DotNet v4

Description

Monitors URI performance counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - URI Performance Counters DotNet v4	inetinfoservicesglobal.uri.cache.misses	InetInfoServicesGlobal URICacheMisses	NULL	Total number of unsuccessful lookups in the URI cache
	inetinfoservicesglobal.uri.cache.hits	InetInfoServicesGlobal URICacheHits	NULL	Total number of successful lookups in the URI cache
	inetinfoservicesglobal.uri.cache.hits.percent	InetInfoServicesGlobal URICacheHitsPercent	%	The ratio of URI Cache Hits to total cache requests
	inetinfoservicesglobal.uri.cache.flushes	InetInfoServicesGlobal URICacheFlushes	NULL	URI Cache Flushes since server startup

Agent G2 - Virtual Memory in GB DotNet v4

Description

Monitors Virtual Memory in GB on windows servers using “CommittedBytes” property from “Win32_PerfFormattedData_PerfOS_Memory” WMI class

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Virtual Memory in GB DotNet v4	virtual.memory	Virtual Memory	NULL	Amount of committed virtual memory, in bytes. Committed memory is physical memory for which space has been reserved on the disk paging file in case it must be written back to disk. This property displays the last observed value only; it is not an average.

Agent G2 - VMware Windows VCenter Certificates Expiry

Description

Monitors VMware Windows vCenter certificates expiry in days.

Prerequisites

This template will be applicable to VMware Windows vCenter Appliance and tested in vmware version: VMware VirtualCenter 6.5.0 build-16613358

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - VMware Windows vCenter Certificates Expiry Monitor	vmware_windows_vcenter_certificates_expiry_inDays	VMware Windows vCenter Certificates Expiry In Days	Days	It Monitors the VMware windows vCenter certificates expiry in days

Agent G2 - VMWare-View VDI Performance Counters

Description

Monitors Connection Server status, Desktop VM Count, Number of DRS Migrations, ESXi Hosts without Lockdown mode enabled, etc.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - VMWare-View VDI Performance Counters	VMHostCPU	Average CPU Usage on ESX servers	%	Average CPU Usage on ESX servers (in %)
	DesktopVMCount	Desktop VM Count	NULL	Desktop VM Count
	VMHostNet	Average Network Throughput on ESX servers	KBps	Average Network Throughput on ESX servers (in KBps)
	VMHostDisk	Average Disk Throughput on ESX servers	KBps	Average Disk Throughput on ESX servers (in KBps)
	InventoryDetails	Inventory Details	NULL	NULL
	VcenterServerStatus	VCenter Server Status	NULL	VCenter Server Status. Possible values are 1 - Is Connected and 0 - Not Connected
	VMHostMemory	Average Memory Usage on ESX servers	%	Average Memory Usage on ESX servers (in %)

Agent G2 - Web Interface ASP Performance Counters DotNet v4

Description

Monitors ASP counters on the web interface

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Web Interface ASP Performance Counters DotNet v4	RequestsCurrent	RequestsCurrent	NULL	The current number of requests both executing and queued
	RequestsQueued	RequestsQueued	NULL	The number of requests waiting to be processed
	RequestExecutionTime	RequestExecutionTime	NULL	The amount of time (in milliseconds) that it took to execute the most recent request
	RequestsRejected	RequestsRejected	NULL	The number of requests rejected because the request queue was full

Agent G2 - Windows Automatic Mode Services Status

Description

To monitor the status of window service(s) which are in automatic start mode. The service(s) which are given in “Excluded Service Name(s)” are not considered for monitoring.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows Automatic Mode Services Status Monitor	system_windows_automaticMode_servicesStatus	System Windows AutomaticMode Services Status	NULL	It monitors the status of the windows services which are in Automatic mode

Agent G2 - Windows CertStore Certificates Expiry

Description

Monitors the windows cert store certificates expiry in days.

Prerequisites

This template will be applicable to all windows servers (which are having powershell 3.0 and above) and tested in windows server 2012.

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows CertStore Certificates Expiry Monitor	windows_certStore_certificates_expiry_inDays	Windows CertStore Certificates Expiry In Days	Days	It Monitors the windows cert store certificates expiry in days

Agent G2 - Windows CertStore Certificates Expiry v2

Description

To monitor certificate(s) expiry (in days) which are available in windows registry.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows CertStore Certificates Expiry Monitor v2	windows_certStore_certificates_expiry_inDays	Windows CertStore Certificates Expiry In Days	Days	It Monitors the windows cert store certificates expiry in days

Agent G2 - Windows CertStore Certificates Expiry - v3

Description

To monitor certificate(s) expiry (in days) which are available in windows registry.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows CertStore Certificates Expiry Monitor - v3	windows_certStore_certificates_expiry_inDays	Windows CertStore Certificates Expiry In Days	Days	It Monitors the windows cert store certificates expiry in days

Agent G2 - Windows CertStore Certificates Expiry - IssuedTo_SN as component

Description

To monitor certificate(s) expiry (in days) which are available in Certificate Manager and not yet expired. This template contains “Issued To and Serial Number” in alert subject.

Template Usage Guidelines:

The script receives its parameters from custom monitor during Runtime.

Params field in the custom monitor holds the certificate store path, the excluded Thumbprints OR the keyword “all”

Formulate your Path params in the format specified below and encode the string. The string has two parts to it separated by a semicolon ( ; ).

The Certificate Store paths are separated by a comma (,) and are present to the left to the semicolon separator.

The list of Thumbprints that needs to be excluded from the monitor are comma (,) separated and are present to the right of the semicolon separator.

The error or warning alerts contains Certificate information specifying respective certificate’s Issuer, Subject, Serial Number.

Case 1: Giving input as specific paths and excluding few certificates from those paths(using their thumbprints)

Example String Before Encoding:

cert:\LocalMachine\Root, cert:\LocalMachine\AuthRoot;a8985d3a65e5e5c4b2d7d66d40c6dd2fb19c5436,df3c24f9bfd666761b268073fe06d1cc8d4f82a4

Example String After Encoding: (use a tool like notepad++ or online resource like https://www.base64encode.org/ to encode your params string)

Y2VydDpcTG9jYWxNYWNoaW5lXFJvb3QsY2VydDpcTG9jYWxNYWNoaW5lXEF1dGhSb290O+KAjmE4OTg1ZDNhNjVlNWU1YzRiMmQ3ZDY2ZDQwYzZkZDJmYjE5YzU0MzYs4oCOZGYzYzI0ZjliZmQ2NjY3NjFiMjY4MDczZmUwNmQxY2M4ZDRmODJhNA==

Case 2: Monitoring all the certificates from all folders or Current User account and Local Machine account

To monitor all the certificates user needs to give input as “all”

Prerequisite

Powershell Version 3 and above.

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows CertStore Certificates Expiry - IssuedTo_SN as component	windows_certStore_certificatesExpiryInDays	Windows CertStore CertificatesExpiry InDays	Days	To monitor certificate(s) expiry (in days) which are available in Certificate Manager.

Agent G2 - Windows Cluster Monitoring

Description

Template to monitor windows cluster parameters like cluster node state, cluster group state, cluster group failover status and this template need to be assigned on all cluster nodes. This template is tested in "Microsoft Windows Server 2012 R2 Datacenter" cluster environment.

Prerequisites:

Powershell 2.0 and above
root\mscluster namespace available on target windows cluster machine.

Limitations:

Get same alerts on multiple nodes, If the user applies this template on multiple cluster nodes.

Note: As the cluster commands return the same information on any of the cluster nodes.

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows Cluster Custom Monitor	system_windows_cluster_node_state	System Windows Cluster Node State	None	Monitoring windows cluster node state - Below are the possible states: -1:UNKNOWN 0:UP 1:DOWN 2:PAUSED 3:JOINING
	system_windows_cluster_group_state	System Windows Cluster Group State	None	Monitoring windows cluster group state - Below are the possible states: -1:UNKNOWN 0:ONLINE 1:OFFLINE 2:FAILED 3:PARTIAL ONLINE 4:PENDING
	system_windows_cluster_group_failover_status	System Windows Cluster Group Failover Status	None	System Windows Cluster Group Failover Status - Below are the possible states: 0 - Cluster group currently running on preferred node 1 - Preferred node(s) not defined 2 - Cluster group change from one node to another due to failover.
	system_windows_cluster_resource_state	System Windows Cluster Resource State	None	System Windows Cluster Resource State - Below are the possible values: -1 - UNKNOWN 0 - INHERITED 1 - INITIALIZING 2 - ONLINE 3 - OFFLINE 4 - FAILED 128 - PENDING 129 - ONLINE PENDING 130 - OFFLINE PENDING
	system_windows_cluster_service_status	System Windows Cluster Service Status	None	System Windows Cluster Service Status - Below are the possible values. 1 - Cluster service down 0 - Cluster service up and running.

Agent G2 - Windows CPU Core Utilization - v2

Description

Agent G2 - Windows CPU Core Utilization: To monitor the CPU utilization in each core level.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Windows CPU Core Utilization Monitor - v2	system_windows_CPU_Core_Utilization	Windows Core CPU Utilization	%	To monitor the CPU utilization of each core level.

Agent G2 - Windows CPU Monitors DotNet v4

Description

Monitors ProcessorQueueLength, PercentProcessorTime, PercentUserTime, PercentPrivilegedTime

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows CPU Monitors DotNet v4	PercentPrivilegedTime	PercentPrivilegedTime	NULL	% Privileged Time is the percentage of elapsed time that the process threads spent executing code in privileged mode. When a Windows system service in called, the service will often run in privileged mode to gain access to system-private data. Such data is protected from access by threads executing in user mode. Calls to the system can be explicit or implicit, such as page faults or interrupts. Unlike some early operating systems, Windows uses process boundaries for subsystem protection in addition to the traditional protection of user and privileged modes. Some work done by Windows on behalf of the application might appear in other subsystem processes in addition to the privileged time in the process.
	PercentUserTime	PercentUserTime	NULL	NULL
	ProcessorQueueLength	ProcessorQueueLength	NULL	The System/Processor Queue Length counter shows how many threads are ready in the processor queue, but not currently able to use the processor.
	PercentProcessorTime	PercentProcessorTime	%	% Processor Time is the percentage of elapsed time that all of process threads used the processor to execution instructions. An instruction is the basic unit of execution in a computer, a thread is the object that executes instructions, and a process is the object created when a program is run. Code executed to handle some hardware interrupts and trap conditions are included in this count.

Agent G2 - Windows DHCP Server

Description

Windows DHCP Server IPv4 Metrics

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows DHCP Server Monitor	windows_dhcp_server_Deniedduetomatch	Windows Dhcp Server Denied Due to Match	count	Number of DHCP requests denied, based on matches from the Deny List.
	windows_dhcp_server_FailoverTransitionstoCOMMUNICATIONINTERRUPTEDstate	Windows Dhcp Server Failover Transitions to COMMUNICATION INTERRUPTED State	count	Number of transitions into COMMUNICATION INTERRUPTED state
	windows_dhcp_server_FailoverTransitionstoPARTNERDOWNstate	Windows Dhcp Server Failover Transitions to PARTNER DOWN State	count	Number of transitions into PARTNER DOWN state
	windows_dhcp_server_MillisecondsperpacketAvg	Windows Dhcp Server Milliseconds PerPacket Avg	ms	The average time per packet taken by the DHCP server to send a response.
	windows_dhcp_server_RequestsPersec	Windows Dhcp Server Requests Persec	counts/s	Rate of DHCP Requests received by the DHCP server.
	windows_dhcp_server_OfferQueueLength	Windows Dhcp Server Offer Queue Length	count	The Number of packets in the offer queue of the DHCP server.
	windows_dhcp_server_InformsPersec	Windows Dhcp Server Informs Persec	counts/s	Rate of DHCP Informs received by the DHCP server.
	windows_dhcp_server_FailoverBndUpdreceivedPersec	Windows Dhcp Server FailoverBnd Upd Received Persec	counts/s	Number of DHCP failover Binding Update messages received.
	windows_dhcp_server_DiscoversPersec	Windows Dhcp Server Discovers Persec	counts/s	Rate of DHCP Discovers received by the DHCP server.
	windows_dhcp_server_ReleasesPersec	Windows Dhcp Server Releases Persec	counts/s	Rate of DHCP Releases received by the DHCP server.
	windows_dhcp_server_FailoverBndUpdsentPersec	Windows Dhcp Server Failover Bnd Upd Sent Persec	counts/s	Number of DHCP failover Binding Update messages sent.
	windows_dhcp_server_FailoverTransitionstoRECOVERstate	Windows Dhcp Server Failover Transitions to RECOVER State	count	Number of transitions into RECOVER state
	windows_dhcp_server_PacketsReceivedPersec	Windows Dhcp Server Packets Received Persec	counts/s	Packets Received/sec is the rate at which packets are received by the DHCP server.
	windows_dhcp_server_ActiveQueueLength	Windows Dhcp Server Active Queue Length	count	The Number of packets in the processing queue of the DHCP server.
	windows_dhcp_server_FailoverBndAckreceivedPersec	Windows Dhcp Server FailoverBndAck Received Persec	counts/s	Number of DHCP failover Binding Ack messages received.
	windows_dhcp_server_FailoverBndUpdpendinginoutboundqueue	Windows Dhcp Server FailoverBnd Upd Pending InOutBound Queue	count	Number of pending outbound DHCP failover Binding Update messages.
	windows_dhcp_server_DuplicatesDroppedPersec	Windows Dhcp Server Duplicates Dropped Persec	counts/s	Duplicates Dropped/sec is the rate at which the DHCP server received duplicate packets.
	windows_dhcp_server_FailoverBndAcksentPersec	Windows Dhcp Server FailoverBndAck Sent Persec	counts/s	Number of DHCP failover Binding Ack messages sent.
	windows_dhcp_server_OffersPersec	Windows Dhcp Server Offers Persec	counts/s	Rate of DHCP Offers sent out by the DHCP server.
	windows_dhcp_server_DeclinesPersec	Windows Dhcp Server Declines Persec	counts/s	Rate of DHCP Declines received by the DHCP server.
	windows_dhcp_server_NacksPersec	Windows Dhcp Server Nacks Persec	counts/s	Rate of DHCP Nacks sent by the DHCP server.
	windows_dhcp_server_AcksPersec	Windows Dhcp Server Acks Persec	counts/s	Rate of DHCP Acks sent by the DHCP server.
	windows_dhcp_server_FailoverBndUpdDropped	Windows Dhcp Server FailoverBnd Upd Dropped	count	Number of binding updates dropped
	windows_dhcp_server_PacketsExpiredPersec	Windows Dhcp Server Packets Expired Persec	counts/s	Packets Expired/sec is the rate at which packets get expired in the DHCP server message queue.
	windows_dhcp_server_Deniedduetononmatch	Windows Dhcp Server Denied Due to NonMatch	count	Number of DHCP requests denied, based on non-matches from the Allow List.
	windows_dhcp_server_ConflictCheckQueueLength	Windows Dhcp Server Conflict Check Queue Length	count	The Number of packets in the DHCP server queue waiting on conflict detection (ping).

Agent G2 - Windows DHCP Server IPv4

Description

Windows DHCP Server IPv4 Statistics

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows DHCP Server IPv4 Monitor	windows_dhcp_serverv4statistics_AddressesInUse	Windows Dhcp Serverv4 Statistics Addresses InUse	count	Addresses in use across IPV4 scopes on the DHCP server.
	windows_dhcp_serverv4statistics_FreeAddressesPercentage	Windows Dhcp Serverv4 Statistics FreeAddresses Percentage	%	Percentage of addresses available.
	windows_dhcp_serverv4statistics_FreeAddresses	Windows Dhcp Serverv4 Statistics Free Addresses	count	Addresses available across all scopes on the Dhcp server.
	windows_dhcp_serverv4_SuperScopeFreeAddresses	Windows Dhcp Serverv4 SuperScope Free Addresses	count	Number of free addresses that can be leased out to DHCPv4 clients in the Superscope.
	windows_dhcp_serverv4_SuperScopeAddressesInUse	Windows Dhcp Serverv4 SuperScope Addresses InUse	count	Number of addresses leased out to DHCPv4 clients in the Superscope.
	windows_dhcp_serverv4_SuperScopeFreeAddressesPercentage	Windows Dhcp Serverv4 SuperScope FreeAddresses Percentage	%	SuperScope addresses Free percentage.

Agent G2 - Windows DHCP Server IPv6

Description

Windows DHCP Server IPv6 Statistics

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows DHCP Server IPv6 Monitor	windows_dhcp_serverv6scopestatistics_ScopeFreeAddresses	Windows Dhcp Serverv6 Scope Statistics Scope Free Addresses	count	Addresses available across IPV6 scopes on the Dhcp server.
	windows_dhcp_serverv6statistics_RebindsPerSec	Windows Dhcp Serverv6 Statistics Rebinds PerSec	counts/s	Number of rebinds received by the Dhcp server.
	windows_dhcp_serverv6scopestatistics_ScopeUsedAddressesPercentage	Windows Dhcp Serverv6 Scope Statistics Scope UsedAddresses Percentage	%	Percentage of addresses in use.
	windows_dhcp_serverv6_PacketsExpiredPersec	Windows Dhcp Serverv6 Packets Expired Persec	counts/s	Packets Expired/sec is the rate at which packets get expired in the DHCPv6 server message queue.
	windows_dhcp_serverv6statistics_DeclinesPerSec	Windows Dhcp Serverv6 Statistics Declines PerSec	counts/s	Number of declines received by the Dhcp server.
	windows_dhcp_serverv6_AcksPersec	Windows Dhcp Serverv6 Acks Persec	counts/s	Rate of DHCP Acks sent by the DHCP Server v6.
	windows_dhcp_serverv6statistics_InformsPerSec	Windows Dhcp Serverv6 Statistics Informs PerSec	counts/s	Number of informs received by the Dhcp server.
	windows_dhcp_serverv6_MillisecondsperpacketAvg	Windows Dhcp Serverv6 Milliseconds PerPacket Avg	ms	The average time per packet taken by the DHCPv6 server to send a response.
	windows_dhcp_serverv6statistics_ReleasesPerSec	Windows Dhcp Serverv6 Statistics Releases PerSec	counts/s	Number of releases received by the Dhcp server.
	windows_dhcp_serverv6statistics_FreeAddresses	Windows Dhcp Serverv6 Statistics Free Addresses	count	Addresses available across all scopes on the Dhcp server.
	windows_dhcp_serverv6statistics_FreeAddressesPercentage	Windows Dhcp Serverv6 Statistics FreeAddresses Percentage	%	Percentage of addresses available.
	windows_dhcp_serverv6_PacketsReceivedPersec	Windows Dhcp Serverv6 Packets Received Persec	counts/s	Packets Received/sec is the rate at which packets are received by the DHCPv6 server.
	windows_dhcp_serverv6statistics_AdvertisesPerSec	Windows Dhcp Serverv6 Statistics Advertises PerSec	counts/s	Number of advertises received by the Dhcp server.
	windows_dhcp_serverv6statistics_RenewsPerSec	Windows Dhcp Serverv6 Statistics Renews PerSec	counts/s	Number of renews received by the Dhcp server.
	windows_dhcp_serverv6_ActiveQueueLength	Windows Dhcp Serverv6 Active Queue Length	count	The Number of packets in the processing queue of the DHCPv6 server.
	windows_dhcp_serverv6_DuplicatesDroppedPersec	Windows Dhcp Serverv6 Duplicates Dropped Persec	counts/s	Duplicates Dropped/sec is the rate at which the DHCPv6 server received duplicate packets.
	windows_dhcp_serverv6scopestatistics_ScopeAddressesInUse	Windows Dhcp Serverv6 Scope Statistics ScopeAddresses InUse	count	Addresses in use across IPV6 scopes on the DHCP server.
	windows_dhcp_serverv6statistics_solicitsPerSec	Windows Dhcp Serverv6 Statistics Solicits PerSec	counts/s	Number of solicits received by the Dhcp server.
	windows_dhcp_serverv6statistics_AddressesInUse	Windows Dhcp Serverv6 Statistics Addresses In Use	count	Addresses in use across IPV6 scopes on the DHCP server.
	windows_dhcp_serverv6statistics_RequestsPerSec	Windows Dhcp Serverv6 Statistics Requests Persec	counts/s	Number of requests received by the Dhcp server.
	windows_dhcp_serverv6statistics_ConfirmsPerSec	Windows Dhcp Serverv6 Statistics Confirms PerSec	counts/s	Number of confirms received by the Dhcp server.

Agent G2 - Windows Directory Monitor - v2

Description

To monitor both directory/file(s) in windows local directories and network shares like UNC,NFS with regex support.

Prerequisites

If the user does not provide the depth value in that case we are not considering sub-directories.
If the user wants to monitor different files in the same directory/sub-directory then they can provide that information as another input argument with proper regex pattern for file filtering.
Donot have support for authentication based Network shares.

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Windows Directory Monitor - v2	system_directory_FileSize	System Directory File Size	KB	System Directory File Size: To monitor the each file size in a given directory path and filtering files based on the given regex pattern.
	system_directory_FileSizeTotal	System Directory FileSizeTotal	MB	System Directory FileSizeTotal: To monitor the total size of filtered files in a given directory based on the given regex pattern.
	system_directory_Size	System Directory Size	GB	System Directory Size: To monitor the total size of the given directory/file path.
	system_directory_FileCount	System Directory File Count	count	System Directory File Count: To monitor the file count in a given directory based on the given regex pattern.
	system_directory_file_ReadOnlyStatus	System Directory File ReadOnlyStatus	NULL	System Directory File ReadOnlyStatus - To monitor the Filtered File(s) Read Accessibility. 0 - Read Only, 1 - Other than Read Only
	system_directory_Availability	System Directory Availability	NULL	System Directory Availability: To monitor the availability of the given Directory/File path. Below are the possible states: 1 - Available, 0 - Not Available

Agent G2 - Windows Directory Monitor - v3

Description

To monitor both directory/file(s) in windows local directories and network shares like UNC,NFS with regex support.

Prerequisites

If the user does not provide the depth value in that case we are not considering sub-directories.
If the user wants to monitor different files in the same directory/sub-directory then they can provide that information as another input argument with proper regex pattern for file filtering.
Donot have support for authentication based Network shares.

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Windows Directory Monitor - v3	system_directory_FileSize	System Directory File Size	KB	System Directory File Size: To monitor the each file size in a given directory path and filtering files based on the given regex pattern.
	system_directory_FileSizeTotal	System Directory FileSizeTotal	MB	System Directory FileSizeTotal: To monitor the total size of filtered files in a given directory based on the given regex pattern.
	system_directory_Size	System Directory Size	GB	System Directory Size: To monitor the total size of the given directory/file path.
	system_directory_FileCount	System Directory File Count	count	System Directory File Count: To monitor the file count in a given directory based on the given regex pattern.
	system_directory_file_ReadOnlyStatus	System Directory File ReadOnlyStatus	NULL	System Directory File ReadOnlyStatus - To monitor the Filtered File(s) Read Accessibility. 0 - Read Only, 1 - Other than Read Only
	system_directory_Availability	System Directory Availability	NULL	System Directory Availability: To monitor the availability of the given Directory/File path. Below are the possible states: 1 - Available, 0 - Not Available

Agent G2 - Windows Disk Usage Performance Counters DotNet v4

Description

Monitors Windows Disk Usage Performance Counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows Disk Usage Performance Counters DotNet v4	LogicalDiskReadsPersec	LogicalDiskReadsPersec	NULL	Disk Reads/sec is the rate of read operations on the disk.
	PhysicalDiskWritesPersec	PhysicalDiskWritesPersec	NULL	Disk Writes/sec is the rate of write operations on the disk.
	PhysicalDiskReadsPersec	PhysicalDiskReadsPersec	NULL	Disk Reads/sec is the rate of read operations on the disk.
	LogicalDiskWritesPersec	LogicalDiskWritesPersec	NULL	Disk Writes/sec is the rate of write operations on the disk.

Agent G2 - Windows Logical Disk Performance Counters DotNet v4

Description

Monitors Windows Logical Disk Performance Counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows Logical Disk Performance Counters DotNet v4	LogicalAvgDisksecPerWrite	LogicalAvgDisksecPerWrite	NULL	Avg. Disk sec/Write is the average time, in seconds, for write operations to the disk.
	LogicalAvgDisksecPerRead	LogicalAvgDisksecPerRead	NULL	Avg. Disk sec/Read is the average time, in seconds, for read operations on the disk.

Agent G2 - Windows Memory Monitoring

Description

Agent G2 - Windows Service Monitoring v2.0

Prerequisites

No prerequisite

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows Memory Custom Monitor	system.windows.memory.available	System Windows Memory Available	MB	Available MBytes is the amount of physical memory, in Megabytes, immediately available for allocation to a process or for system use. It is equal to the sum of memory assigned to the standby (cached), free and zero page lists.

Agent G2 - Windows Memory Performance Counters DotNet v4

Description

Monitors Windows Memory Performance Counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows Memory Performance Counters DotNet v4	PageFaultsPersec	PageFaultsPersec	psec	Page Faults/sec is the average number of pages faulted per second. It is measured in number of pages faulted per second because only one page is faulted in each fault operation, hence this is also equal to the number of page fault operations. This counter includes both hard faults (those that require disk access) and soft faults (where the faulted page is found elsewhere in physical memory.) Most processors can handle large numbers of soft faults without significant consequence. However, hard faults, which require disk access, can cause significant delays.
	PagesPersec	PagesPersec	KBps	Pages/sec is the rate at which pages are read from or written to disk to resolve hard page faults. This counter is a primary indicator of the kinds of faults that cause system-wide delays. It is the sum of Memory Pages Input/sec and Memory Pages Output/sec.
	PercentUsage	PercentUsage	NULL	The amount of the Page File instance in use in percent.
	AvailableMBytes	AvailableMBytes	MB	Available MBytes is the amount of physical memory, in Megabytes, immediately available for allocation to a process or for system use.

Agent G2 - Windows MSFT Disk Health

Description

This template monitors Windows MSFT Disk Health status metrics like system_windows_MSFT_disk_operationalStatus, system_windows_MSFT_disk_healthStatus, system_windows_MSFT_physicalDisk_operationalStatus, system_windows_MSFT_physicalDisk_healthStatus, system_windows_MSFT_virtualDisk_operationalStatus, system_windows_MSFT_virtualDisk_healthStatus

Prerequisites

End device must have the below WMI namespace and classes to get the monitoring data: WMI Namespace: root\Microsoft\Windows\Storage system_windows_MSFT_disk Class: MSFT_Disk system_windows_MSFT_physicalDisk Class: MSFT_PhysicalDisk system_windows_MSFT_virtualDisk Class: MSFT_VirtualDisk

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows MSFT Disk Health	system_windows_MSFT_disk_operationalStatus	System Windows MSFT Disk OperationalStatus	Status	Monitors the operational status of the disk device. Possible states: 0 - Unknown, 1 - Other, 2 - OK, 3 - Degraded, 4 - Stressed, 5 - Predictive Failure, 6 - Error, 7 - Non-Recoverable Error, 8 - Starting, 9 - Stopping, 10 - Stopped, 11 - In Service, 12 - No Contact, 13 - Lost Communication, 14 - Aborted, 15 - Dormant, 16 - Supporting Entity in Error, 17 - Completed, 53264 - Online, 53265 - Not Ready, 53266 - No Media, 53267 - Offline, 53268 - Failed
	system_windows_MSFT_disk_healthStatus	System Windows MSFT Disk HealthStatus	Status	Monitors the health status of the disk device. Possible States: 0 - Healthy, 1 - Warning, 2 - Unhealthy
	system_windows_MSFT_physicalDisk_operationalStatus	System Windows MSFT PhysicalDisk OperationalStatus	Status	Monitors the operational status of the PhysicalDisk. Possible States: 0 - Unknown, 1 - Other, 2 - OK, 3 - Degraded, 4 - Stressed, 5 - Predictive Failure, 6 - Error, 7 - Starting, 8 - Stopping, 9 - Stopped, 10 - In Service, 11 - No Contact, 12 - Lost Communication, 13 - Aborted, 14 - Dormant, 15 - Supporting Entity in Error, 16 - Completed, 17 - Power Mode, 18 - Relocating, 19 - Microsoft Reserved, 53252 - Failed Media, 53253 - Split, 53254 - Stale Metadata, 53255 - IO Error, 53256 - Unrecognized Metadata, 53257 - Microsoft Reserved
	system_windows_MSFT_physicalDisk_healthStatus	System Windows MSFT PhysicalDisk HealthStatus	Status	Monitors the health status of the physical disk. A high-level indication of device health. Possible State: 0 - Healthy, 1 - Warning, 2 - Unhealthy, 3 - Unknown
	system_windows_MSFT_virtualDisk_operationalStatus	System Windows MSFT VirtualDisk OperationalStatus	Status	Monitors the operational status of the Virtual Disk. Unlike HealthStatus, this property indicates the status of hardware, software, and infrastructure issues related to this virtual disk, and can contain multiple values. Possible Values: 0 - Unknown, 1 - Other, 2 - OK, 3 - Degraded, 4 - Stressed, 5 - Predictive Failure, 6 - Error, 7 - Non-Recoverable Error, 8 - Starting, 9 - Stopping, 10 - Stopped, 11 - In Service, 12 - No Contact, 13 - Lost Communication, 14 - Aborted, 15 - Dormant, 16 - Supporting Entity in Error, 17 - Completed, 18 - Power Mode, 19 - Relocating, 53250 - Detached, 53251 - Incomplete
	system_windows_MSFT_virtualDisk_healthStatus	System Windows MSFT VirtualDisk HealthStatus	Status	Monitors the health status of the virtual disk. Health of a virtual disk is derived from the health of the backing physical disks, and whether or not the virtual disk can maintain the required levels of resiliency. Possible States: 0 - Healthy, 1 - Warning, 2 - Unhealthy, 3 - Unknown

Agent G2 - Windows Printer

Description

This template monitors Windows Printer metrics like system_windows_printer_status, system_windows_printer_spoolerPrintQueueJobs

Prerequisites

Device should contain the below WMI Namespace and classes to get the monitoring data. WMI Namespace: root\cimv2 system_windows_printer_status Class: Win32_Printer system_windows_printer_spoolerPrintQueueJobs Class: Win32_PerfFormattedData_Spooler_PrintQueue

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows Printer	system_windows_printer_status	System Windows Printer Status	Status	Monitors the status information for a printer that is different from information specified in the logical device Availability property. Possible States: 1 - Other, 2 - Unknown, 3 - Idle, 4 - Printing, 5 - Warmup, 6 - Stopped Printing, 7 - Offline
Agent G2 - Windows Printer	system_windows_printer_spoolerPrintQueueJobs	System Windows Spooler PrintQueue Jobs	count	Monitors the current number of jobs in a print queue.

Agent G2 - Windows Network Interface Monitoring

Description

Agent G2 - Windows Network Interface Monitoring

Prerequisites

No prerequisite

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows Network Interface Custom Monitor	system.windows.network.interface.packets.persec	System Windows Network Interface Packets Per Sec	packets/sec	Packets/sec is the rate at which packets are sent and received on the network interface.
	system.windows.network.interface.traffic.in	System Windows Network Interface Traffic In	bps	Bytes Received/sec is the rate at which bytes are received over each network adapter, including framing characters. Network Interface\\Bytes Received/sec is a subset of Network Interface\\Bytes Total/sec.
	system.windows.network.interface.traffic.out	System Windows Network Interface Traffic Out	bps	Bytes Sent/sec is the rate at which bytes are sent over each network adapter, including framing characters. Network Interface\\Bytes Sent/sec is a subset of Network Interface\\Bytes Total/sec.
	system.windows.network.interface.traffic.total	System Windows Network Interface Traffic Total	bps	Bytes Total/sec is the rate at which bytes are sent and received over each network adapter, including framing characters. Network Interface\\Bytes Total/sec is a sum of Network Interface\\Bytes Received/sec and Network Interface\\Bytes Sent/sec.

Agent G2 - Windows Network Interface Monitoring - v3

Description

Monitors Windows Network Interface metrics. In this version of template, we have added support for new metrics, and we have also modified the metric names from the existing dotted notation to underscore format.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows Network Interface Custom Monitor - v3	system_windows_network_interface_status	System Windows Network Interface Status	null	NetConnectionStatus is a string indicating the state of the network adapter's connection to the network. The value of the property is to be interpreted as follows: 0 - Disconnected 1 - Connecting 2 - Connected 3 - Disconnecting 4 - Hardware not present 5 - Hardware disabled 6 - Hardware malfunction 7 - Media disconnected 8 - Authenticating 9 - Authentication succeeded 10 - Authentication failed 11 - Invalid Address 12 - Credentials Required Other (13?65535)
	system_windows_network_interface_currentBandwidth	System Windows Network Interface CurrentBandwidth	bps	Current Bandwidth is an estimate of the current bandwidth of the network interface in bits per second (BPS). For interfaces that do not vary in bandwidth or for those where no accurate estimation can be made, this value is the nominal bandwidth.
	system_windows_network_interface_packetsReceivedPersec	System Windows Network Interface PacketsReceivedPersec	psec	Packets Received/sec is the rate at which packets are received on the network interface.
	system_windows_network_interface_packetsSentPersec	System Windows Network Interface PacketsSentPersec	psec	Packets Sent/sec is the rate at which packets are sent on the network interface.
	system_windows_network_interface_packetsReceivedNonUnicastPersec	System Windows Network Interface PacketsReceivedNonUnicastPersec	psec	Packets Received Non-Unicast/sec is the rate at which non-unicast (subnet broadcast or subnet multicast) packets are delivered to a higher-layer protocol.
	system_windows_network_interface_packetsReceivedUnicastPersec	System Windows Network Interface PacketsReceivedUnicastPersec	psec	Packets Received Unicast/sec is the rate at which (subnet) unicast packets are delivered to a higher-layer protocol.
	system_windows_network_interface_packetsSentNonUnicastPersec	System Windows Network Interface PacketsSentNonUnicastPersec	psec	Packets Sent Non-Unicast/sec is the rate at which packets are requested to be transmitted to non-unicast (subnet broadcast or subnet multicast) addresses by higher-level protocols. The rate includes the packets that were discarded or not sent.
	system_windows_network_interface_packetsSentUnicastPersec	System Windows Network Interface PacketsSentUnicastPersec	psec	Packets Sent Unicast/sec is the rate at which packets are requested to be transmitted to subnet-unicast addresses by higher-level protocols. The rate includes the packets that were discarded or not sent.
	system_windows_network_interface_offloadedConnections	System Windows Network Interface OffloadedConnections	count	Offloaded Connections is the number of TCP connections (over both IPv4 and IPv6) that are currently handled by the TCP chimney offload capable network adapter.
	system_windows_network_interface_packetsOutboundErrors	System Windows Network Interface PacketsOutboundErrors	count	Packets Outbound Errors is the number of outbound packets that could not be transmitted because of errors.
	system_windows_network_interface_packetsReceivedErrors	System Windows Network Interface PacketsReceivedErrors	count	Packets Received Errors is the number of inbound packets that contained errors preventing them from being deliverable to a higher-layer protocol.
	system_windows_network_interface_outputQueueLength	System Windows Network Interface OutputQueueLength	count	Output Queue Length is the length of the output packet queue (in packets). If this is longer than two, there are delays and the bottleneck should be found and eliminated, if possible. Since the requests are queued by the Network Driver Interface Specification (NDIS) in this implementation, this will always be 0.
	system_windows_network_interface_packetsReceivedDiscarded	System Windows Network Interface PacketsReceivedDiscarded	count	Packets Received Discarded is the number of inbound packets that were chosen to be discarded even though no errors had been detected to prevent their delivery to a higher-layer protocol. One possible reason for discarding packets could be to free up buffer space.
	system_windows_network_interface_packetsOutboundDiscarded	System Windows Network Interface PacketsOutboundDiscarded	count	Packets Outbound Discarded is the number of outbound packets that were chosen to be discarded even though no errors had been detected to prevent transmission. One possible reason for discarding packets could be to free up buffer space.
	system_windows_network_interface_utilization	System Windows Network Interface Utilization	%	Network Interface utilization in percentage.
	system_windows_network_interface_trafficIn	System Windows Network Interface TrafficIn	bps	Bytes Received/sec is the rate at which bytes are received over each network adapter, including framing characters. Network Interface\Bytes Received/sec is a subset of Network Interface\Bytes Total/sec.
	system_windows_network_interface_trafficOut	System Windows Network Interface TrafficOut	bps	Bytes Sent/sec is the rate at which bytes are sent over each network adapter, including framing characters. Network Interface\Bytes Sent/sec is a subset of Network Interface\Bytes Total/sec.
	system_windows_network_interface_trafficTotal	System Windows Network Interface TrafficTotal	bps	Bytes Total/sec is the rate at which bytes are sent and received over each network adapter, including framing characters. Network Interface\Bytes Total/sec is a sum of Network Interface\Bytes Received/sec and Network Interface\Bytes Sent/sec.
	system_windows_network_interface_packetsPersec	System Windows Network Interface PacketsPersec	packets/sec	Packets/sec is the rate at which packets are sent and received on the network interface.

Agent G2 - Windows Network Interface Monitoring - v2

Description

Agent G2 - Windows Network Interface Monitoring - v2

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows Network Interface Monitoring - v2	system.windows.network.interface.packets.received.persec	System Windows Network Interface Packets Received Per Sec	packets/sec	PacketsReceived/sec is the rate at which packets are received on the network interface.
system.windows.network.interface.packets.sent.persec	System Windows Network Interface Packets Sent Per Sec	packets/sec	PacketsSentPerSec is the rate at which packets are sent on the network interface.
system.windows.network.interface.traffic.out	System Windows Network Interface Traffic Out	bps	Bytes Sent/sec is the rate at which bytes are sent over each network adapter, including framing characters. Network Interface\\Bytes Sent/sec is a subset of Network Interface\\Bytes Total/sec.
system.windows.network.interface.packets.persec	System Windows Network Interface Packets Per Sec	packets/sec	Packets/sec is the rate at which packets are sent and received on the network interface.
system.windows.network.interface.traffic.in	System Windows Network Interface Traffic In	bps	Bytes Received/sec is the rate at which bytes are received over each network adapter, including framing characters. Network Interface\\Bytes Received/sec is a subset of Network Interface\\Bytes Total/sec.
system.windows.network.interface.traffic.total	System Windows Network Interface Traffic Total	bps	Bytes Total/sec is the rate at which bytes are sent and received over each network adapter, including framing characters. Network Interface\\Bytes Total/sec is a sum of Network Interface\\Bytes Received/sec and Network Interface\\Bytes Sent/sec.

Agent G2 - Windows NTP Offset

Description

Monitors the Network Time Protocol (NTP) offset on a specified server, provided as an argument. It calculates the time offset between the local machine and the NTP server in seconds.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows NTP Offset Monitor	windows_ntp_offset	windows_ntp_offset	s

Agent G2 - Windows Registry Monitoring

Description

Agent G2 - Windows Registry Monitoring

Prerequisites

No prerequisite

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows Registry Custom Monitor	system.windows.registry.quota.usage	System Windows Registry Quota Usage	%	% Registry Quota In Use is the percentage of the Total Registry Quota Allowed that is currently being used by the system. This counter displays the current percentage value only; it is not an average.

Agent G2 - Windows Reliability Stability Index

Description

Monitors the Windows Reliability Stability Index Min, Max, Avg, and Latest Index values from the Win32_ReliabilityStabilityMetrics class for a specified number of past hours. The stability index ranges from 1 (least stable) to 10 (most stable). You can use the index to help evaluate the reliability of a computer.

Template Usage Guidelines

This template will calculate the reliability index Min, Max, Avg, and Latest values on last 2 hours data by default. If the user wants, they can get Min, Max, Avg, and Latest values on up to the last 48 hours of data.

Examples: While assigning the template, user can specify 1 OR 2 OR 3 OR ……. OR 48

Prerequisites

Agent version 14.0.0 or later. The end device must contain the below WMI details to get the monitoring data: WMI Namespace: root\cimv2 WMI Class: Win32_ReliabilityStabilityMetrics

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows Reliability Stability Index	system_windows_reliabilityStabilityIndexBest	System Windows Reliability Stability Index Best	null	Monitors the Windows Reliability Stability Index for Maximum Index value. The stability index ranges from 1 (least stable) to 10 (most stable). You can use the index to help evaluate the reliability of a computer.
	system_windows_reliabilityStabilityIndexWorst	System Windows Reliability Stability Index Worst	null	Monitors the Windows Reliability Stability Index for Minimum Index value. The stability index ranges from 1 (least stable) to 10 (most stable). You can use the index to help evaluate the reliability of a computer.
	system_windows_reliabilityStabilityIndexAvg	System Windows Reliability Stability Index Average	null	Monitors the Windows Reliability Stability Index for Average Index value. The stability index ranges from 1 (least stable) to 10 (most stable). You can use the index to help evaluate the reliability of a computer.
	system_windows_reliabilityStabilityIndexLatest	System Windows Reliability Stability Index Latest	null	Monitors the Windows Reliability Stability Index for Latest Index value. The stability index ranges from 1 (least stable) to 10 (most stable). You can use the index to help evaluate the reliability of a computer.

Agent G2 - Windows Services Monitoring

Description

Agent G2 - Windows Services Monitoring

Prerequisites

Provide ServiceNames with comma separated as input parameters while applying the template at device level.
Example: opsramp-agent,opsramp-shield,power.

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows Services Custom Monitor	system.windows.service.status	System Windows Service Status	NULL	It gives the current status of the given service name(s), In graph 1 - Running & 0 - Stopped

Agent G2 - Windows Service Monitoring v2.0

Description

It monitors the windows service monitoring with Regex support.

Prerequisites

Provide service names as input arguments separated by commas when applying the template at the device level, along with support for regular expressions.

Syntax: serviceName1,serviceName2,regexPattern1,regexPattern2.

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows Services Custom Monitor v2.0	System_Windows_Service_Status_Ext	System Windows Service Status Ext	NULL	It gives the current status of the services by matching with the given service name(s) or regex patterns(s). Below are the possible values: Stopped - 0, Running - 1, Start Pending - 2, Stop Pending - 3, Continue Pending - 4, Pause Pending - 5, Paused - 6, Unknown - 7

Agent G2 - Windows Service Monitoring - v3

Description

To monitor the windows services status

Template Usage Guidelines:

When assigning this template on the device, users need to pass specific input parameters. These parameters should be provided as one or more service names (not the service display names) or service name regex patterns.
To provide multiple service names or service name regex patterns, seperate them with commas.
SAMPLE CUSTOM SCRIPT ARGUMENTS:
Example 1(With regex): ^opsramp,agent$,Power
Example 2(Without Regex): Netlogon,Dnscache,RpcEptMapper

Prerequisites

No prerequisite

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows Services Custom Monitor - v3	System_Windows_Service_Status_Ext	System Windows Service Status Ext		It gives the current status of the services by matching with the given service name(s) or regex patterns(s). Below are the possible values: Stopped - 0, Running - 1, Start Pending - 2, Stop Pending - 3, Continue Pending - 4, Pause Pending - 5, Paused - 6, Unknown - 7

Agent G2 - Windows Mountpoint Monitoring

Description

Agent G2 - Windows Mountpoint Monitoring

Prerequisites

No prerequisite

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows Mountpoint Custom Monitor	system.windows.mountpoint.disk.freespace	System Windows MountPoint Disk FreeSpace	MB	Shows the free space of mounted disks in MB.
Agent G2 - Windows Mountpoint Custom Monitor	system.windows.mountpoint.disk.usage	System Windows MountPoint Disk Usage	%	Shows the utilization space of mounted disks in percentage.

Agent G2 - Windows MountPoint Monitoring DotNet v4

Description

Monitors Windows Mounted disks Freespace and Utilization

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows MountPoint Monitoring DotNet v4	Utilization	Mount Point Utilization	NULL	Mount point drive disk utilization
Agent G2 - Windows MountPoint Monitoring DotNet v4	MountedDisks_FreeSpaceinBytes	Mounted Disks Free Space	MB	Shows the free space of mounted disks in MB

Agent G2 - Windows Network Performance Counters DotNet v4

Description

Monitors Windows Network Performance Counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows Network Performance Counters DotNet v4	Network_Interface_PacketsOutboundDiscarded	Network Interface Packets Outbound Discarded	NULL	Number of outbound packets that were chosen to be discarded even though no errors had been detected to prevent transmission. One possible reason for discarding packets could be to free up buffer space.
	Network_Interface_BytesReceivedPersec	Network Interface Traffic In	NULL	Rate at which bytes are received over each network adapter, including framing characters. Network Interface Bytes Received/sec is a subset of Network Interface Bytes Total/sec.
	Network_Interface_BytesTotalPersec	Network Interface Traffic Total	bps	Bytes Total/sec is the rate at which bytes are sent and received over each network adapter, including framing characters. Network Interface Bytes Total/sec is a sum of Network Interface Bytes Received/sec and Network Interface Bytes Sent/sec. From the device we are getting the result in Bytes/Sec. So, we are converting the Bytes/Sec to Bits/Sec.
	Network_Interface_OffloadedConnections	Network Interface Offloaded Connections	Count	Offloaded Connections is the number of TCP connections (over both IPv4 and IPv6) that are currently handled by the TCP chimney offload capable network adapter.
	Network_Interface_PacketsReceivedErrors	Network Interface Packets Received Errors	Count	Packets Received Errors is the number of inbound packets that contained errors preventing them from being deliverable to a higher-layer protocol.
	Network_Interface_PacketsReceivedDiscarded	Network Interface Packets Received Discarded	NULL	Number of inbound packets that were chosen to be discarded even though no errors had been detected to prevent delivery to a higher-layer protocol. One possible reason for discarding such a packet could be to free up buffer space.
	Network_Interface_OutputQueueLength	Network Interface Output Queue Length	NULL	Output Queue Length is the length of the output packet queue (in packets). If this is longer than two, there are delays and the bottleneck should be found and eliminated, if possible. Since the requests are queued by the Network Driver Interface Specification (NDIS) in this implementation, this will always be 0.
	Network_Interface_Utilization	Network Interface Utilization	Percentage	Rate of bytes transferred with respect to the speed of the interface. Formula used to get the Network Utilization Percentage for a specific interface is (((BytesTotalPersec x 8) / CurrentBandwidth) x 100)
	Network_Interface_PacketsOutboundErrors	Network Interface Packets Outbound Errors	Count	Packets Outbound Errors is the number of outbound packets that could not be transmitted because of errors.
	Network_Interface_BytesSentPersec	Network Interface Traffic Out	NULL	Bytes Sent/sec is the rate at which bytes are sent over each network adapter, including framing characters. Network Interface Bytes Sent/sec is a subset of Network Interface Bytes Total/sec. From the device we are getting the result in Bytes/Sec. So, we are converting the Bytes/Sec to Bits/Sec.

Agent G2 - Windows NFS Mount Point Monitoring

Description

Template to monitor windows nfs mount points availability, accessibility and utilization. This template need to assigned on all windows machines which are having NFS mount points. This template tested in “Microsoft Windows Server 2019 Datacenter Evaluation” + NFS mount points available.

Prerequisites

Powershell 2.0 and above & Mount points(which are related to NFS file system) available on target device.

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows NFS Mount Point Custom Monitor	system_windows_nfs_mountpoint_accessibility	System Windows NFS Mount Point Accessibility	NULL	System Windows NFS Mount Point Accessibility - Below are the possible values:\n1 - Read/Write access not available\n0 - Read/Write access available
	System Windows NFS Mount Point Accessibility - Below are the possible values:\n1 - Read/Write access not available\n0 - Read/Write access available	System Windows NFS Mount Point Utilization	%	System Windows NFS Mount Point Utilization
	system_windows_nfs_mountpoint_availability	System Windows NFS Mount Point Availability	NULL	System Windows NFS Mount Point Availability - Below are the possible values:\n1 - NFS Mount Point Not Available\n0 - NFS Mount Point Available

Agent G2 - Windows OS Performance Monitoring

Description

Agent G2 - Windows OS Performance Monitoring

Prerequisites

No prerequisite

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - CPU Monitor	system.cpu.usage.utilization	System CPU Utilization	%	The percentage of elapsed time that the processor spends to execute a non-Idle thread (This doesn't include CPU steal time).
Agent G2 - Disk Monitor	system.disk.usage.freespace	System Free Disk Usage	GB	Monitors the Free Space usage in GB.
	system.disk.usage.usedspace	System Disk Used Space	GB	Monitors disk used space in GB.
	system.disk.usage.utilization	System Disk Utilization	%	Monitors disk utilization in percentage.
Agent G2 - Memory Monitor	system.memory.usage.usedspace	System Memory Used Space	GB	Physical and virtual memory usage in GB.
Agent G2 - Memory Monitor	system.memory.usage.utilization	System Memory Utilization	%	Physical and virtual memory usage in percentage.
Agent G2 - Uptime Monitor	system.os.uptime	System Uptime	m	Time lapsed since last reboot in minutes.
Agent G2 - Windows Network Monitor	system.network.interface.utilization	System Network Utilization	%	Monitors Network Utilization of each interface for Windows Device.

Agent G2 - Windows PhysicalDisk CurrentDiskQueueLength DotNet v4

Description

Monitors PhysicalDisk CurrentDiskQueueLength

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows PhysicalDisk CurrentDiskQueueLength DotNet v4	physicaldisk.currentdiskqueuelength	PhysicalDisk CurrentDiskQueueLength	NULL	Current Disk Queue Length is the number of requests outstanding on the disk at the time the performance data is collected. It also includes requests in service at the time of the collection. This is a instantaneous snapshot, not an average over the time interval. Multi-spindle disk devices can have multiple requests that are active at one time, but other concurrent requests are awaiting service. This counter might reflect a transitory high or low queue length, but if there is a sustained load on the disk drive, it is likely that this will be consistently high. Requests experience delays proportional to the length of this queue minus the number of spindles on the disks. For good performance, this difference should average less than two.

Agent G2 - Windows Process Monitoring

Description

Agent G2 - Windows Process Monitoring

Prerequisites

No prerequisite

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows Process Custom Monitor	system.windows.process.count	System Windows Process Count	count	Gives ProcessCount of the given Process.
	system.windows.process.handlecount	System Windows Process Handlecount	count	Gives HandleCount of the given Process.
	system.windows.process.pagefilebytes	System Windows Process PageFileBytes	Bytes	Gives PageFileBytes of the given Process in Bytes.
	system.windows.process.processorcoretime.percent	System Windows Process Processor Core Time Percent	%	Gives Process ProcessorCoreTime of the given Process in Percentage.
	system.windows.process.processortime.percent	System Windows Process Processor Time Percent	%	Monitors the CPU usage percentage of a given process.
	system.windows.process.threadcount	System Windows Process ThreadCount	count	Gives ThreadCount of the given Process.
	system.windows.process.workingset	System Windows Process WorkingSet	KB	Monitors the current memory usage of a given process in KB

Agent G2 - Windows Process Monitoring - v2 DotNet v4

Description

Monitors Windows Process Monitoring metrics like: Windows Process Count Windows Process HandleCount, Windows Process WorkingSet, Windows Process ProcessorTime Percent, Windows Process ThreadCount, Windows Process ProcessorCoreTime Percent, Windows Process PageFileBytes.

Note: Provide regex patterns with delimiter (@@@) separation to monitor multiple processes and also provide Friendly Name of each process with delimiter (;;;). Here Friendly name will be used as a component in graph and alert. Eg1: chrome.;;;chrome Eg2: notepad.;;;notepad@@@chrome\.exe;;;chrome

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows Process Monitoring - v2 DotNet v4	windows.process.workingset	Windows Process WorkingSet	KB	Gives WorkingSet of the given Process in KB.
	windows.process.processorcoretime.percent	Windows Process ProcessorCoreTime Percent	%	Gives Process ProcessorCoreTime of the given Process in Percentage.
	windows.process.count	Windows Process Count	Count	Gives ProcessCount of the given Process.
	windows.process.pagefilebytes	Windows Process PageFileBytes	Bytes	Gives PageFileBytes of the given Process in Bytes.
	windows.process.processortime.percent	Windows Process ProcessorTime Percent	%	Gives Process ProcessorTime of the given Process in Percentage.
	windows.process.handlecount	Windows Process HandleCount	Count	Gives HandleCount of the given Process.
	windows.process.threadcount	Windows Process ThreadCount	Count	Gives ThreadCount of the given Process.

Agent G2 - Windows Process Monitoring DotNet v4

Description

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows Process Monitoring DotNet v4	windows.process.pagefilebytes	Windows Process PageFileBytes	Bytes	Gives PageFileBytes of the given Process in Bytes.
	windows.process.threadcount	Windows Process ThreadCount	Count	Gives ThreadCount of the given Process.
	windows.process.processorcoretime.percent	Windows Process ProcessorCoreTime Percent	%	Gives Process ProcessorCoreTime of the given Process in Percentage.
	windows.process.processortime.percent	Windows Process ProcessorTime Percent	%	Gives Process ProcessorTime of the given Process in Percentage.
	windows.process.handlecount	Windows Process HandleCount	Count	Gives HandleCount of the given Process.
	windows.process.workingset	Windows Process WorkingSet	KB	Gives WorkingSet of the given Process in KB.
	windows.process.count	Windows Process Count	Count	Gives ProcessCount of the given Process.

Agent G2 - Windows Remote Desktop Session Licenses DotNet v4

Description

Monitors Windows Remote Desktop Session Licenses

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows Remote Desktop Session Licenses DotNet v4	tslicensekeypack.availablelicenses	TSLicenseKeyPack AvailableLicenses	NULL	Total number of available licenses in the Remote Desktop Services license key pack.

Agent G2 - Windows System Performance Counters DotNet v4

Description

Monitors Windows System Performance Counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows System Performance Counters DotNet v4	ProcessorQueueLength	ProcessorQueueLength	NULL	The System/Processor Queue Length counter shows how many threads are ready in the processor queue, but not currently able to use the processor.
	CurrentDiskQueueLength	CurrentDiskQueueLength	NULL	Current Disk Queue Length is the number of requests outstanding on the disk at the time the performance data is collected. It also includes requests in service at the time of the collection. This is a instantaneous snapshot, not an average over the time interval. Multi-spindle disk devices can have multiple requests that are active at one time, but other concurrent requests are awaiting service. This counter might reflect a transitory high or low queue length, but if there is a sustained load on the disk drive, it is likely that this will be consistently high. Requests experience delays proportional to the length of this queue minus the number of spindles on the disks. For good performance, this difference should average less than two.
	ContextSwitchesPersec	ContextSwitchesPersec	NULL	A context switch occurs when the kernel switches the processor from one thread to another-for example, when a thread with a higher priority than the running thread becomes ready. The System Context Switches/sec counter in System Monitor reports systemwide context switches

Agent G2 - Windows VMware vCenter Service Status - v2

Description

Monitors VMware vCenter Service(s) status. It is applicable to Windows VMware vCenter vSphere 6.5 or later. Validated on: Microsoft Windows Server 2016 with vSphere 6.5

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows VMware Vcenter Service Status Monitor - v2	vmware_vcenter_service_Status	vmware_vcenter_service_Status	NULL	Monitors VMware vCenter Service(s) status. \nService Running: Graph Value - 0, Alert Severity - Ok\nService Stopped: Graph Value - 2, Alert Severity - Critical\nService Unknown: Reasons for unknown could be any of these: \n1. The service could be changing from running to stopped or stopped to running \n2. Service name could be invalid

Agent G2 - Windows WMI Performance Counters Monitoring

Description

Agent G2 - Windows WMI Performance Counters Monitoring

Prerequisites

No prerequisite

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows WMI Counter Custom Monitor	system.windows.wmi.counter	System Windows WMI Counter	NULL	Monitors Windows WMI Performance counters data

Agent G2 Linux Individual CPU Monitoring

Description

Agent G2 Linux Individual CPU Monitoring

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Linux CPU Core Utilization Monitor	system_linux_CPU_Core_Utilization	System Linux CPU Core Utilization	%	System Linux CPU Core Utilization

Agent G2 - Linux - Zookeeper Template - v2

Description

ZooKeeper is monitored through JMX.

Prerequisites

No Prerequisites

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - Zookeeper Template - v2	zookeeper.bytes_received	ZooKeeper Total Bytes Received	MB	The number of bytes received
	zookeeper.bytes_sent	ZooKeeper Total Bytes Sent	MB	The number of bytes sent
	zookeeper.connections	ZooKeeper Total Connections	Connections	The total count of client connections
	zookeeper.latency.avg	ZooKeeper Average Request Latency	MS	The amount of time it takes for the server to respond to a client request
	zookeeper.latency.max	ZooKeeper Max Request Latency	MS	The amount of time it takes for the server to respond to a client request
	zookeeper.latency.min	ZooKeeper Min Request Latency	MS	The amount of time it takes for the server to respond to a client request
	zookeeper.nodes	ZooKeeper Total Node Count	Nodes	The number of znodes in the ZooKeeper namespace
	zookeeper.outstanding_requests	ZooKeeper OutStanding Requests	Requests	The number of queued requests when the server is under load and is receiving more sustained requests than it can process
	zookeeper.packets_received	ZooKeeper Total Packets Received	packet/second	The number of packets received
	zookeeper.packets_sent	ZooKeeper Total Packets sent	packet/second	The number of packets sent
	zookeeper.zxid.count	ZooKeeper Zxid Count	count	Zxid Count
	zookeeper.zxid.epoch	ZooKeeper Zxid Epoch	value	Zxid Epoch

G2 Microsoft Active Directory RID LDAP FSMO Response

Description

G2 Microsoft Active Directory RID LDAP FSMO Response

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
G2 Microsoft Active Directory RID LDAP FSMO Response	microsoft_AD_RID_LDAP_FSMO_PingResponse	Microsoft Active Directory RID LDAP FSMO Ping Response in Milliseconds	ms	Microsoft Active Directory RID LDAP FSMO ping response in milliseconds
G2 Microsoft Active Directory RID LDAP FSMO Response	microsoft_AD_RID_LDAP_FSMO_BindResponse	Microsoft Active Directory RID LDAP FSMO Bind Response in Milliseconds	ms	Microsoft Active Directory RID LDAP FSMO bind response in milliseconds

G2 Microsoft Active Directory RID Master Status

Description

G2 Microsoft Active Directory RID Master Status

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
G2 Microsoft Active Directory RID Master Status	microsoft_AD_RID_RIDMaster_OverallStatus	Microsoft AD RID RIDMaster Overall Status	NULL	Microsoft Active Directory RID master overall status. Test Passed - 0, Failed - 1
G2 Microsoft Active Directory RID Master Status	microsoft_AD_RID_RIDMaster_Bindstatus	Microsoft AD RID RIDMaster Bind Status	NULL	Microsoft Active Directory RID master bind status. Successful - 0, Failed - 1

G2 Microsoft Active Directory RID Statistics

Description

G2 Microsoft Active Directory RID Statistics

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
G2 Microsoft Active Directory RID Statistics	microsoft_AD_RID_RIDsIssued	Microsoft AD RID RIDs Issued	count	Microsoft Active Directory RIDs issued count
G2 Microsoft Active Directory RID Statistics	microsoft_AD_RID_RIDsRemaining	Microsoft AD RID RIDs Remaining	count	Microsoft Active Directory RIDs remaining count